KEGG   Homo sapiens (human): 26275
Entry
26275             CDS       T01001                                 
Symbol
HIBCH, HIBYLCOAH
Name
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa00410  beta-Alanine metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00852  Valine degradation
Disease
H01349  Methacrylic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    26275 (HIBCH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    26275 (HIBCH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    26275 (HIBCH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     26275 (HIBCH)
SSDB
Motif
Pfam: ECH_2 ECH_1 DUF4600
Other DBs
NCBI-GeneID: 26275
NCBI-ProteinID: NP_055177
OMIM: 610690
HGNC: 4908
Ensembl: ENSG00000198130
Pharos: Q6NVY1(Tbio)
UniProt: Q6NVY1 A0A140VJL0
Structure
LinkDB
Position
2:complement(190189735..190319826)
AA seq 386 aa
MGQREMWRLMSRFNAFKRTNTILHHLRMSKHTDAAEEVLLEKKGCTGVITLNRPKFLNAL
TLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTEEDLNNHFKSLGSSDLKF
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggggcagcgcgagatgtggaggctcatgtcgaggtttaatgcattcaaaaggactaat
accatactgcaccatttgagaatgtccaagcacacagatgcagcagaagaggtgctattg
gaaaaaaaaggttgcacgggagtcataacactaaacagaccaaagttcctcaatgcactg
actcttaatatgattcggcagatttatccacagctaaagaagtgggaacaagatcctgaa
actttcctgatcattataaagggagcaggaggaaaggctttctgtgccgggggtgatatc
agagtgatctcggaagctgaaaaggcaaaacagaagatagctccagttttcttcagagaa
gaatatatgctgaataatgctgttggttcttgccagaaaccttatgttgcacttattcat
ggaattacaatgggtgggggagttggtctctcagtccatgggcaatttcgagtggctaca
gaaaagtgtctttttgctatgccagaaactgcaataggactgttccctgatgtgggtgga
ggttatttcttgccacgactccaaggaaaacttggttacttccttgcattaacaggattc
agactaaaaggaagagatgtgtacagagcaggaattgctacacactttgtagattctgaa
aagttggccatgttagaggaagatttgttagccttgaaatctccttcaaaagaaaatatt
gcatctgtcttagaaaattaccatacagagtctaagattgatcgagacaagtcttttata
cttgaggaacacatggacaaaataaacagttgtttttcagccaatactgtggaagaaatt
attgaaaacttacagcaagatggttcatcttttgccctagagcaattgaaggtaattaat
aaaatgtctccaacatctctaaagatcacactaaggcaactcatggaggggtcttcaaag
accttgcaagaagtactaactatggagtatcggctaagtcaagcttgtatgagaggtcat
gactttcatgaaggcgttagagctgttttaattgataaagaccagagtccaaaatggaaa
ccagctgatctaaaagaagttactgaggaagatttgaataatcactttaagtctttggga
agcagtgatttgaaattttga

DBGET integrated database retrieval system