KEGG   Homo sapiens (human): 27044
Entry
27044             CDS       T01001                                 
Symbol
SND1, TDRD11, Tudor-SN, p100
Name
(RefSeq) staphylococcal nuclease and tudor domain containing 1
  KO
K15979  staphylococcal nuclease domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    27044 (SND1)
SSDB
Motif
Pfam: SNase TUDOR
Other DBs
NCBI-GeneID: 27044
NCBI-ProteinID: NP_055205
OMIM: 602181
HGNC: 30646
Ensembl: ENSG00000197157
Pharos: Q7KZF4(Tbio)
UniProt: Q7KZF4 A0A140VK49
Structure
LinkDB
Position
7:127652194..128092593
AA seq 910 aa
MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLA
RRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNG
ENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTI
ENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSET
PEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWS
IAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKL
NSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELL
AAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRL
KLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
MDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAH
YEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIAS
HPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTL
SPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHV
TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA
DDADEFGYSR
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggcgtcctccgcgcagagcggcggctcctccgggggacccgcggtccccaccgtgcag
cggggcatcatcaagatggtcctctcagggtgcgccatcattgtccgaggtcagcctcgt
ggtgggcctcctcctgagcggcagatcaacctcagcaacattcgtgctggaaatcttgct
cgccgggcagccgccacacaacctgatgcaaaggatacccctgatgagccctgggcattt
ccagctcgagagttccttcgaaagaagctgattgggaaggaagtctgtttcacgatagaa
aacaagactccccaggggcgagagtatggcatgatctaccttggaaaagataccaatggg
gaaaacattgcagaatcactggttgcagagggcttagccacccggagagaaggcatgaga
gctaataatcctgagcagaaccggctttcagaatgtgaagaacaagcaaaggcagccaag
aaagggatgtggagtgaggggaacggttcacatactatccgggatctcaagtataccatt
gaaaacccaaggcactttgtggactcacaccaccagaagcctgttaatgctatcatcgag
catgtgcgggacggcagtgtggtcagggccctgctcctcccagattactacctggttaca
gtcatgctgtcaggcatcaagtgcccaacttttcgacgggaagcagatggcagtgaaact
ccagagccttttgctgcagaagccaaatttttcactgagtcgcgactgcttcagagagat
gttcagatcattctggagagctgccacaaccagaacattctgggtaccatccttcatcca
aatggcaacatcacagagctcctcctgaaggaaggtttcgcacgctgtgtggactggtcg
attgcagtttacacccggggcgcagaaaagctgagggcggcagagaggtttgccaaagag
cgcaggctgagaatatggagagactatgtggctcccacagctaatttggaccaaaaggac
aagcagtttgttgccaaggtgatgcaggttctgaatgctgatgccattgttgtgaagctg
aactcaggcgattacaagacgattcacctgtccagcatccgaccaccgaggctggagggg
gagaacacccaggataagaacaagaaactgcgtcccctgtatgacattccttacatgttt
gaggcccgggaatttcttcgaaaaaagcttattgggaagaaggtcaatgtgacggtggac
tacattagaccagccagcccagccacagagacagtgcctgccttttcagagcgtacctgt
gccactgtcaccattggaggaataaacattgctgaggctcttgtcagcaaaggtctagcc
acagtgatcagataccggcaggatgatgaccagagatcatcacactacgatgaactgctt
gctgcagaggccagagctattaagaatggcaaaggattgcatagcaagaaggaagtgcct
atccaccgtgttgcagatatatctggggatacccaaaaagcaaagcagttcctgcctttt
cttcagcgggcaggtcgttctgaagctgtggtggaatacgtcttcagtggttctcgtctc
aaactctatttgccaaaggaaacttgccttatcaccttcttgcttgcaggcattgaatgc
cccagaggagcccgaaacctcccaggcttggtgcaggaaggagagcccttcagcgaggaa
gctacacttttcaccaaggaactggtgctgcagcgagaggtggaggtggaggtggagagc
atggacaaggccggcaactttatcggctggctgcacatcgacggtgccaacctgtccgtc
ctgctggtggagcacgcgctctccaaggtccacttcaccgccgaacgcagctcctactac
aagtccctgctgtctgccgaggaggccgcaaagcagaagaaagagaaggtctgggcccac
tatgaggagcagcccgtggaggaggtgatgccagtgctggaggagaaggagcgatctgct
agctacaagcccgtgtttgtgactgagatcactgatgacctgcacttctacgtgcaggat
gtggagaccggcacccagttggagaagctgatggagaacatgcgcaatgacattgccagt
cacccccctgtagagggctcctatgccccccgcaggggagagttctgcattgccaaattt
gtagatggagaatggtaccgtgcccgagtagagaaagtcgagtctcctgccaaaatacat
gtcttctacattgactacggcaacagagaggtcctgccatccacccgcctgggtacccta
tcacctgccttcagcactcgggtgctgccagctcaagccacggagtatgccttcgccttc
atccaggtgccccaagatgatgatgcccgcacggacgccgtggacagcgtagttcgggat
atccagaacactcagtgcctgctcaacgtggaacacctgagtgccggctgcccccatgtc
accctgcagtttgcagattccaagggcgatgtggggctgggcttggtgaaggaagggctg
gtcatggtggaggtgcgcaaggagaaacagttccagaaagtgatcacagaatacctgaat
gcccaagagtcagccaagagcgccaggctgaacctgtggcgctatggagactttcgagct
gatgatgcagacgaatttggctacagccgctaa

DBGET integrated database retrieval system