KEGG   Homo sapiens (human): 27097
Entry
27097             CDS       T01001                                 

Gene name
TAF5L, PAF65B
Definition
(RefSeq) TATA-box binding protein associated factor 5 like
  KO
K03130  transcription initiation factor TFIID subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    27097 (TAF5L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    27097 (TAF5L)
   03036 Chromosome and associated proteins [BR:hsa03036]
    27097 (TAF5L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     27097 (TAF5L)
   Coactivators
    SAGA/TFTC/STAGA complex
     27097 (TAF5L)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     27097 (TAF5L)
    STAGA complex
     27097 (TAF5L)
    TFTC complex
     27097 (TAF5L)
    SAGA complex
     27097 (TAF5L)
    SLIK complex
     27097 (TAF5L)
SSDB
Motif
Pfam: WD40 TFIID_NTD2 ANAPC4_WD40 Ge1_WD40 Nbas_N
Other DBs
NCBI-GeneID: 27097
NCBI-ProteinID: NP_055224
HGNC: 17304
Ensembl: ENSG00000135801
Vega: OTTHUMG00000039463
Pharos: O75529(Tbio)
UniProt: O75529
LinkDB
Position
1q42.13
AA seq 589 aa
MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSA
APCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFY
SRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQ
SDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALE
VLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSK
KLKSEPHQVDVSRIHLACDILEEEDDEDDNAGTEMKILRGHCGPVYSTRFLADSSGLLSC
SEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLR
IYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNG
KYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIR
NTYCSAPADGSSSELVGVYTGQMSNVLSVQFMACNLLLVTGITQENQEH
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaaacgagtgcgtaccgagcagattcagatggcagtgtcctgctacctcaaacgccgg
cagtacgtggactcagatggtcccctgaagcaaggactgcggctgtcacagactgctgaa
gagatggcggccaatctaacagtgcaatcagaatctggttgtgccaacatagtgtctgca
gccccttgccaggcagaaccccagcaatatgaagtacagtttggacgactgcggaatttt
ctcactgattctgattcccagcatagccacgaagtgatgcctctcctctatcctctcttt
gtctacctccatctcaacctggtccaaaacagtccgaagagcacagtggaaagtttttac
agccgcttccatggaatgtttctgcagaatgctagccagaaggatgtcattgagcagcta
cagaccactcaaaccatccaggacatcctatctaacttcaagcttcgagcattcctagat
aacaagtacgtggtccgtctccaagaagacagctacaactaccttatccgctacctccaa
agtgacaacaatactgccctgtgcaaagtcctcaccttacatattcatcttgacgtgcag
cctgccaagagaacagactatcagctgtatgccagtggcagctcctcccgcagtgagaac
aacggtttggagccccccgacatgcccagccctattctgcagaacgaggctgccctagag
gtcttacaggagagcattaagcgagtcaaggatgggcctccctccctcactaccatctgc
ttctatgccttctataacacagagcagctgttgaacactgcagaaatctcccccgatagc
aagctgcttgctgctgggtttgacaactcctgtataaaactttggagtttacgatccaag
aagttaaaatcagagccccaccaagtagacgtgtcccgcatccatttggcttgtgatatt
ctggaggaggaggatgatgaggatgataatgcaggcacggagatgaagatactgcggggc
cactgcggaccagtgtacagcacgaggttcctcgcggacagctcagggttgctctcttgt
tctgaagacatgtccatcagatactgggatctggggagtttcaccaacactgtgttgtac
caaggacatgcctatcctgtgtgggatctggacatcagtccatatagcctgtacttcgcc
agcgggtcccacgaccgcaccgccaggctgtggtcatttgatcggacgtacccgctgagg
atatatgcaggacacctggcagatgtggactgtgtcaaattccaccctaattcaaactac
ttggccacgggctcaaccgacaagaccgtccggctgtggagcgctcagcaggggaactcg
gtgaggcttttcacaggccaccgtggccccgtgctttctctcgccttttctcccaacggt
aagtacttggcgtctgctggcgaggaccagcggttgaagctgtgggacttggcctctggg
accctttataaagagttgagaggccacacagacaatatcaccagcctcaccttcagtcca
gacagcggcttgattgcctctgcctccatggacaactcggtgcgcgtctgggacatcagg
aacacttactgcagtgcacctgccgacggctcctccagcgagctcgtgggcgtgtacacc
gggcagatgagcaacgtcctgagcgtgcagttcatggcctgtaaccttcttctggtgact
ggaattacacaagaaaatcaggaacattaa

KEGG   Homo sapiens (human): 6877
Entry
6877              CDS       T01001                                 

Gene name
TAF5, TAF(II)100, TAF2D, TAFII-100, TAFII100
Definition
(RefSeq) TATA-box binding protein associated factor 5
  KO
K03130  transcription initiation factor TFIID subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6877 (TAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6877 (TAF5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6877 (TAF5)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6877 (TAF5)
   Coactivators
    SAGA/TFTC/STAGA complex
     6877 (TAF5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     6877 (TAF5)
    STAGA complex
     6877 (TAF5)
    TFTC complex
     6877 (TAF5)
    SAGA complex
     6877 (TAF5)
    SLIK complex
     6877 (TAF5)
SSDB
Motif
Pfam: WD40 TFIID_NTD2 ANAPC4_WD40 Nup160 Ge1_WD40 RAB3GAP2_N DUF773 eIF2A Cytochrom_D1
Other DBs
NCBI-GeneID: 6877
NCBI-ProteinID: NP_008882
OMIM: 601787
HGNC: 11539
Ensembl: ENSG00000148835
Vega: OTTHUMG00000018985
Pharos: Q15542(Tbio)
UniProt: Q15542
LinkDB
Structure
PDB: 

Position
10q24.33
AA seq 800 aa
MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGD
GGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREA
GLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASG
PAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLF
YPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDF
RTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLA
GEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPN
APPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTD
DSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILY
GHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYF
VSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGN
CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS
RDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPV
VHLHFTRRNLVLAAGAYSPQ
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggcggcgctggcggaggagcagacggaggtggcggtcaagctagagcctgagggaccg
ccaacgctgctacctccgcaggcgggggacggcgcaggcgagggtagcggcggcactacc
aacaacggccccaacggcggcggcgggaacgttgcggcgtcgtcgtccactggcggggat
ggcgggacccccaagcccacggtggctgtctccgccgctgccccggcgggggcggccccg
gtgcccgccgctgctccggacgccggcgctccgcatgaccgacagactctactggccgtg
ctgcagttcctacggcagagcaaactccgcgaggccgaagaggcgctgcgccgtgaggcc
gggctgctggaggaggcagtggcgggctccggagccccgggagaggtggacagcgccggc
gctgaggtgaccagcgcgcttctcagccgggtgaccgcctcggcccctggccctgcggcc
cccgaccctccgggcactggcgcttcgggggccacggtcgtctcaggttcagcctcaggt
cctgcggctccgggtaaagttggaagtgttgctgtggaagaccagccagatgtcagtgcc
gtgttgtcagcctacaaccaacaaggagatcccacaatgtatgaagaatactatagtgga
ctgaaacacttcattgaatgttccctggactgccatcgggcagagttgtcccaacttttt
tatcctctgtttgtgcacatgtacttggagctagtctacaatcaacatgagaatgaagca
aagtcattctttgagaagttccatggagatcaggaatgttattaccaggatgacctacga
gtattatctagtcttaccaaaaaggaacacatgaaagggaatgagaccatgttggatttt
cgaacaagtaaatttgttctgcgtatttcccgtgactcgtaccaactcttgaagaggcat
cttcaggagaaacagaacaatcagatatggaacatagttcaggagcacctctacattgac
atctttgatgggatgccgcgtagtaagcaacagatagatgcgatggtgggaagtttggca
ggagaggctaaacgagaggcaaacaaatcaaaggtattttttggtttattaaaagaacca
gaaattgaggtacctttggatgacgaggatgaagagggagaaaatgaagaaggaaaacct
aaaaagaagaagcctaaaaaagatagtattggatccaaaagcaaaaaacaagatcccaat
gctccacctcagaacagaatccctcttcctgagttgaaagattcagataagttggataag
ataatgaatatgaaagaaaccaccaaacgagtgcgccttgggccggactgcttaccctcc
atttgtttctatacatttctcaatgcttaccagggtctcactgcagtggatgtcactgat
gattctagtctgattgctggaggttttgcagattcaactgtcagagtgtggtcggtaaca
cccaaaaagcttcgtagtgtcaaacaagcatcagatcttagtcttatagacaaagaatca
gatgatgtcttagaaagaatcatggatgagaaaacagcaagtgagttgaagattttgtat
ggtcacagtgggcctgtctacggagccagcttcagtccggataggaactatctgctttcc
tcttcagaggacggaactgttagattgtggagccttcaaacatttacttgtttggtggga
tataaaggacacaactatccagtatgggacacacaattttctccatatggatattatttt
gtgtcagggggccatgaccgagtagctcggctctgggctacagaccactatcagccttta
agaatatttgccggccatcttgctgatgtgaattgtaccagattccatccaaattctaat
tatgttgctacgggctctgcagacagaactgtgcggctctgggacgtcctgaatggtaac
tgtgtaaggatcttcactggacacaagggaccaattcattccttgacattttctcccaat
gggagattcctggctacaggagcaacagatggcagagtgcttctttgggatattggacat
ggtttgatggttggagaattaaaaggccacactgatacagtctgttcacttaggtttagt
agagatggtgaaattttggcatcaggttcaatggataatacagttcgattatgggatgct
atcaaagcctttgaagatttagagaccgatgactttactacagccactgggcatataaat
ttacctgagaattcacaggagttattgttgggaacatatatgaccaaatcaacaccagtt
gtacaccttcattttactcgaagaaacctggttctagctgcaggagcttatagtccacaa
taa

DBGET integrated database retrieval system