KEGG   Homo sapiens (human): 27124
Entry
27124             CDS       T01001                                 
Symbol
INPP5J, INPP5, PIB5PA, PIPP
Name
(RefSeq) inositol polyphosphate-5-phosphatase J
  KO
K24222  inositol polyphosphate 5-phosphatase INPP5J/K [EC:3.1.3.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    27124 (INPP5J)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     27124 (INPP5J)
SSDB
Motif
Pfam: SKICH Exo_endo_phos
Other DBs
NCBI-GeneID: 27124
NCBI-ProteinID: NP_001271214
OMIM: 606481
HGNC: 8956
Ensembl: ENSG00000185133
Vega: OTTHUMG00000151206
Pharos: Q15735(Tbio)
UniProt: Q15735 B4DF95
LinkDB
Position
22:31122923..31134697
AA seq 1006 aa
MEGQSSRGSRRPGTRAGLGSLPMPQGVAQTGAPSKVDSSFQLPAKKNAALGPSEPRLALA
PVGPRAAMSASSEGPRLALASPRPILAPLCTPEGQKTATAHRSSSLAPTSVGQLVMSASA
GPKPPPATTGSVLAPTSLGLVMPASAGPRSPPVTLGPNLAPTSRDQKQEPPASVGPKPTL
AASGLSLALASEEQPPELPSTPSPVPSPVLSPTQEQALAPASTASGAASVGQTSARKRDA
PAPRPLPASEGHLQPPAQTSGPTGSPPCIQTSPDPRLSPSFRARPEALHSSPEDPVLPRP
PQTLPLDVGQGPSEPGTHSPGLLSPTFRPGAPSGQTVPPPLPKPPRSPSRSPSHSPNRSP
CVPPAPDMALPRLGTQSTGPGRCLSPNLQAQEAPAPVTTSSSTSTLSSSPWSAQPTWKSD
PGFRITVVTWNVGTAMPPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFT
DQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNK
GGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFW
FGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKF
DVGTNKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHMEYTVSD
HKPVAAQFLLQFAFRDDMPLVRLEVADEWVRPEQAVVRYRMETVFARSSWDWIGLYRVGF
RHCKDYVAYVWAKHEDVDGNTYQVTFSEESLPKGHGDFILGYYSHNHSILIGITEPFQIS
LPSSELASSSTDSSGTSSEGEDDSTLELLAPKSRSPSPGKSKRHRSRSPGLARFPGLALR
PSSRERRGASRSPSPQSRRLSRVAPDRSSNGSSRGSSEEGPSGLPGPWAFPPAVPRSLGL
LPALRLETVDPGGGGSWGPDREALAPNSLSPSPQGHRGLEEGGLGP
NT seq 3021 nt   +upstreamnt  +downstreamnt
atggagggccagagcagcaggggcagcaggaggccagggacccgggctggcctgggttcc
ctgcccatgccccagggtgttgcccaaactggggcaccctccaaggtggactcaagtttt
cagctcccagcaaagaagaacgcagccctaggaccctcggaaccaaggttggctctggca
cctgtagggccacgggcagctatgtcagcttcctcggaaggaccgaggctggctctggca
tctccccgaccaatcctggctccactgtgtacccctgaagggcagaaaacagctactgcc
caccgcagctccagcctggccccaacatctgtgggccagctggtgatgtctgcctcagct
ggaccaaagcctcccccagcgaccacaggctcagttctggctccgacgtccctggggctg
gtgatgcctgcctcagcagggccaagatctcccccagtcaccctggggcccaatctggcc
ccaacctccagagaccagaagcaggagccacctgcctccgtgggacccaagccaacactg
gcagcctctggcctgagcctggccctggcttctgaggagcagcccccagaactcccctcc
accccttccccggtgcccagtccagttctgtctccaactcaggaacaggccctggctcca
gcatccacggcatcaggcgcagcctctgtgggacagacatcagctagaaagagggatgcc
ccagcccctagacctctccctgcttctgaggggcatctccagcctccagctcagacatct
ggtcctacaggctccccaccctgcatccaaacctccccagaccctcggctctccccctcc
ttccgagcccggcctgaggccctccacagcagccctgaggatcctgttttgccacggcca
ccccagaccttgcccttggatgtgggccagggtccttcagagcctggcactcactcccct
ggacttctgtcccccaccttccggcctggggccccctcaggccagactgtgcccccacct
ctgcccaagccaccccgatcacccagccgttccccaagccactccccgaatcgctctccc
tgtgttcccccagcccctgacatggccctcccaaggcttggcacacagagtacagggcct
ggcaggtgcctgagccccaaccttcaggcccaagaagccccagccccagtcaccacctcc
tcttctacatccaccctgtcatcctccccttggtcagctcagcctacctggaagagcgac
cccggcttccggatcactgtggtcacatggaacgtgggcactgccatgcccccagacgat
gtcacatccctcctccacctgggcggtggtgacgacagcgacggcgcagacatgatcgcc
atagggttgcaggaagtgaactccatgctcaacaagcgactcaaggacgccctcttcacg
gaccagtggagtgagctgttcatggatgcgctagggcccttcaacttcgtgctggtgagt
tcggtgaggatgcagggtgtcatcctgctgctgttcgccaagtactaccacctgcccttc
ctgcgagacgtgcagaccgactgcacgcgcactggcctgggcggctactggggtaacaag
ggtggcgtgagcgtgcgcctggcggccttcgggcacatgctctgcttcctgaactgccac
ttgcctgcgcatatggacaaggcggagcagcgcaaagacaacttccagaccatcctcagc
ctccagcagttccaagggccgggcgcacagggcatcctggatcatgacctcgtgttctgg
ttcggggacctgaacttccgcattgagagctatgacctgcactttgtcaagtttgccatc
gacagtgaccagctccatcagctctgggagaaggaccagctcaacatggccaagaacacc
tggcccattctgaagggctttcaggaggggcccctcaacttcgctcccaccttcaagttt
gatgtgggtaccaacaaatacgataccagtgccaagaaacggaagccagcttggacagac
cgtatcctatggaaggtcaaggctccaggtgggggtcccagcccctcaggacggaagagc
caccgactccaggtgacgcagcacagctaccgcagccacatggaatacacagtcagcgac
cacaagcctgtggctgcccagttcctcctgcagtttgccttcagggacgacatgccactg
gtgcggctggaggtggcagatgagtgggtgcggcccgagcaggcggtggtgaggtaccgc
atggaaacagtgttcgcccgcagctcctgggactggatcggcttataccgggtgggtttc
cgccattgcaaggactatgtggcttatgtctgggccaaacatgaagatgtggatgggaat
acctaccaggtaacattcagtgaggaatcactgcccaagggccatggagacttcatcctg
ggctactatagtcacaaccacagcatcctcatcggcatcactgaacccttccagatctcg
ctgccttcctcggagttggccagcagcagcacagacagctcaggcaccagctcagaggga
gaggatgacagcacactggagctccttgcacccaagtcccgcagccccagtcctggcaag
tccaagcgacaccgcagccgcagcccgggactggccaggttccctgggcttgccctacgg
ccctcatcccgtgaacgccgtggtgccagccgtagcccctcaccccagagccgccgcctg
tcccgagtggctcctgacaggagcagtaatggcagcagccggggcagtagtgaagagggg
ccctctgggttgcctggcccctgggccttcccaccagctgtgcctcgaagcctgggcctg
ttgcccgccttgcgcctagagactgtagaccctggtggtggtggctcctggggacctgat
cgggaggccctggcgcccaacagcctgtctcctagtccccagggccatcgggggctggag
gaagggggcctggggccctga

KEGG   Homo sapiens (human): 3632
Entry
3632              CDS       T01001                                 
Symbol
INPP5A, 5PTASE
Name
(RefSeq) inositol polyphosphate-5-phosphatase A
  KO
K01106  inositol polyphosphate 5-phosphatase INPP5A [EC:3.1.3.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04910  Insulin signaling pathway
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3632 (INPP5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    3632 (INPP5A)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    3632 (INPP5A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     3632 (INPP5A)
SSDB
Motif
Pfam: Exo_endo_phos Glyco_hydro_cc OLF
Other DBs
NCBI-GeneID: 3632
NCBI-ProteinID: NP_005530
OMIM: 600106
HGNC: 6076
Ensembl: ENSG00000068383
Vega: OTTHUMG00000019293
Pharos: Q14642(Tbio)
UniProt: Q14642
LinkDB
Position
10:132537787..132783480
AA seq 412 aa
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKN
YEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQF
DFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDL
VNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSK
SVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGT
ALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKEL
VLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcggggaaggcggccgccccgggcaccgcggtgctgctggtcacggccaacgtgggc
tcgctcttcgacgacccagaaaacctgcagaagaactggcttcgggaattttaccaggtc
gtgcacacacacaagccgcacttcatggccttgcactgtcaggagtttggagggaagaac
tacgaggcctccatgtcccacgtggacaagttcgtcaaagaactattgtcgagtgatgcg
atgaaagaatataacagggctcgagtctacctggatgaaaactacaaatcccaggagcac
ttcacggcactaggaagcttttattttcttcatgagtccttaaaaaacatctaccagttt
gactttaaagctaagaagtatagaaaggtcgctggcaaagagatctactcggatacctta
gagagcacgcccatgctggagaaggagaagtttccgcaggactacttccccgagtgcaaa
tggtcaagaaaaggcttcatccggacgaggtggtgcattgcagactgtgcctttgacttg
gtgaatatccatcttttccatgatgcttccaatctggtcgcctgggaaacaagcccttcc
gtgtactcgggaatccggcacaaggcactgggctacgtgctggacagaatcattgatcag
cgattcgagaaggtttcctactttgtatttggtgatttcaacttccggctggattccaag
tccgtcgtggagacgctctgcacaaaagccaccatgcagacggtccgggccgccgacacc
aatgaagtggtgaagctcatatttcgtgagtcggacaacgaccggaaggttatgctccag
ttagaaaagaaactcttcgactacttcaaccaggaggttttccgagacaacaacggcacc
gcgctcttggagtttgacaaggagttgtctgtctttaaggacagactgtatgaactggac
atctcgttccctcccagctacccgtacagtgaggacgcccgccagggtgagcagtacatg
aacacccggtgcccagcctggtgtgaccgcatcctcatgtccccgtctgccaaggagctg
gtgctgcggtcggagagcgaggagaaggttgtcacctatgaccacattgggcccaacgtc
tgcatgggagaccacaagcccgtgttcctggccttccgaatcatgcccggggcaggtaaa
cctcatgcccatgtgcacaagtgttgtgtcgtgcagtga

KEGG   Homo sapiens (human): 51763
Entry
51763             CDS       T01001                                 
Symbol
INPP5K, MDCCAID, PPS, SKIP
Name
(RefSeq) inositol polyphosphate-5-phosphatase K
  KO
K24222  inositol polyphosphate 5-phosphatase INPP5J/K [EC:3.1.3.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
Disease
H00590  Congenital muscular dystrophies (CMD/MDC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    51763 (INPP5K)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     51763 (INPP5K)
SSDB
Motif
Pfam: SKICH Exo_endo_phos
Other DBs
NCBI-GeneID: 51763
NCBI-ProteinID: NP_057616
OMIM: 607875
HGNC: 33882
Ensembl: ENSG00000132376
Vega: OTTHUMG00000150648
Pharos: Q9BT40(Tbio)
UniProt: Q9BT40
LinkDB
Position
17:complement(1494577..1516612)
AA seq 448 aa
MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGII
SLLSDAAFNDSWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPT
GLFGYWGNKGGVNICLKLYGYYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPN
ILDHDLIIWFGDMNFRIEDFGLHFVRESIKNRCYGGLWEKDQLSIAKKHDPLLREFQEGR
LLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGY
SSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPW
DWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR
SVVGISRPFQIPPGSLREDPLGEAQPQI
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagctcgcggaagctgagcgggccgaaaggcaggaggctcagcatacacgtcgtgact
tggaacgtggcttcggcagcgccccctctagatctcagtgacctgcttcagctgaacaac
cggaacctcaatcttgacatatatgttattggtttgcaggaattgaactctgggatcata
agcctcctttccgatgctgcctttaatgactcgtggagcagtttcctcatggatgtgctt
tcccctctgagcttcatcaaggtctcccatgtccgtatgcaggggatcctcttactggtc
tttgccaagtatcagcatttgccctatatccagattctgtctactaaatccacccccact
ggcctgtttgggtactgggggaacaaaggtggagtcaacatctgcctgaagctttatggc
tactatgtcagcatcatcaactgccacctgcctccccacatttccaacaattaccagcgg
ctggagcactttgaccggatcctggagatgcagaattgtgaggggcgagacatcccaaac
atcctggaccacgacctcattatctggtttggagacatgaactttcggatcgaggacttt
gggttgcactttgttcgggaatccattaaaaatcggtgctacggtggcctgtgggagaag
gaccagctcagcattgccaagaaacatgacccgctgctccgggagttccaggagggccgc
ctactcttcccgcccacctacaagtttgataggaactccaacgactatgacaccagtgag
aaaaaacgcaagcctgcatggaccgatcgcatcctgtggaggctgaagcggcagccctgt
gctggccccgacactcccataccgccggcgtcacacttctccttgtctctgaggggctac
agcagccacatgacgtacggcatcagcgaccacaagcctgtctccggcacgttcgacttg
gagctgaagccattggtgtctgctccgctgatcgtcctgatgcccgaggacctgtggacc
gtggaaaatgacatgatggtcagctactcttcaacctcggacttccccagcagcccgtgg
gactggattggactgtacaaggtggggctgcgggacgttaatgactacgtgtcctatgcc
tgggtcggggacagcaaggtctcctgcagcgacaacctgaaccaggtttacatcgacatc
agcaatatccctaccactgaagatgagtttctcctctgttactacagcaacagtctgcgt
tctgtggtggggataagcagacccttccagatcccgcctggctccttgagggaggaccca
ctgggtgaagcacagccacagatctga

DBGET integrated database retrieval system