KEGG   Homo sapiens (human): 27177
Entry
27177             CDS       T01001                                 
Symbol
IL36B, FIL1, FIL1-(ETA), FIL1H, FILI-(ETA), IL-1F8, IL-1H2, IL1-ETA, IL1F8, IL1H2
Name
(RefSeq) interleukin 36 beta
  KO
K05486  interleukin 36 beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    27177 (IL36B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    27177 (IL36B)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   27177 (IL36B)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 27177
NCBI-ProteinID: NP_055253
OMIM: 605508
HGNC: 15564
Ensembl: ENSG00000136696
Pharos: Q9NZH7(Tbio)
UniProt: Q9NZH7
LinkDB
Position
2:complement(113022089..113052867)
AA seq 164 aa
MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGN
MVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFM
GTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaacccacaacgggaggcagcacccaaatcctatgctattcgtgattctcgacagatg
gtgtgggtcctgagtggaaattctttaatagcagctcctcttagccgcagcattaagcct
gtcactcttcatttaatagcctgtagagacacagaattcagtgacaaggaaaagggtaat
atggtttacctgggaatcaagggaaaagatctctgtctcttctgtgcagaaattcagggc
aagcctactttgcagcttaagcttcagggctcccaagataacatagggaaggacacttgc
tggaaactagttggaattcacacatgcataaacctggatgtgagagagagctgcttcatg
ggaacccttgaccaatggggaataggagtgggtagaaagaagtggaagagttcctttcaa
catcaccatctcaggaagaaggacaaagatttctcatccatgcggaccaacataggaatg
ccaggaaggatgtag

DBGET integrated database retrieval system