KEGG   Homo sapiens (human): 27183
Entry
27183             CDS       T01001                                 
Symbol
VPS4A, CIMDAG, SKD1, SKD1A, SKD2, VPS4, VPS4-1
Name
(RefSeq) vacuolar protein sorting 4 homolog A
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H02548  CIMDAG syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    27183 (VPS4A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27183 (VPS4A)
  09143 Cell growth and death
   04217 Necroptosis
    27183 (VPS4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27183 (VPS4A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    27183 (VPS4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    27183 (VPS4A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    27183 (VPS4A)
SSDB
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 TIP49 AAA_16 AAA_22 RuvB_N IstB_IS21 AAA_5 AAA_14 AAA_25 AAA_18 DUF815 AAA_2 AAA_33 AAA_17 RNA_helicase AAA_24 PhoH NACHT AAA_7 Mg_chelatase DUF5906 Sigma54_activat bpMoxR Sigma54_activ_2 YhdB YCII
Other DBs
NCBI-GeneID: 27183
NCBI-ProteinID: NP_037377
OMIM: 609982
HGNC: 13488
Ensembl: ENSG00000132612
Pharos: Q9UN37(Tbio)
UniProt: Q9UN37 A0A024R705
Structure
LinkDB
Position
16:69311350..69326939
AA seq 437 aa
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKC
VQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
KPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAV
ATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENE
SEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARA
QMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCG
PSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgacaacgtcaaccctccagaaagccattgatctggtgacgaaagccacagaggaggac
aaagccaagaactacgaggaggcgctgcggctgtaccagcatgcggtggagtacttcctc
cacgctatcaagtatgaggcccacagcgacaaggccaaggagagcattcgagccaagtgc
gtgcagtacctagaccgggccgagaagctgaaggattatttacgaagcaaagagaaacac
ggcaagaagccagtcaaagagaaccagagtgagggcaagggcagtgacagtgacagtgaa
ggggataatccggagaaaaagaaactgcaagaacagctgatgggtgccgtcgtgatggag
aagcccaacatacggtggaacgacgtggccgggctggagggggccaaggaggccctcaaa
gaagctgtcattttgccaatcaaattcccacacttgttcacaggcaagcgcaccccctgg
cgggggattctgctgttcggaccccctggcacagggaaatcctacctggccaaagccgtg
gcaacagaggccaacaactccaccttcttctctgtgtcctcctcagatctgatgtccaag
tggctgggggagagtgaaaagctggtcaagaacctgtttgagctggccaggcagcacaag
ccctccatcatcttcatcgatgaggtggattccctctgcgggtcccgaaatgaaaatgag
agtgaggccgcccggaggatcaaaacggagttcttggtccagatgcagggggtggggaat
aacaatgatgggactctggttcttggagccacaaacatcccatgggtgttggattcggcc
atcaggaggaggtttgaaaaacgaatttatatccccttgccggaggaagctgcccgcgcc
cagatgttccggttgcatctcgggagcactccccacaacctcacggatgcaaacatccac
gagctggcccggaagacggaaggctactcgggcgcggacatcagcatcatcgtgcgggac
tctctcatgcagcccgtgaggaaggtgcagtcggccacacacttcaaaaaggtctgtggc
ccctctcgcaccaaccccagcatgatgattgatgacctcctgactccatgctcaccaggg
gacccaggagccatggagatgacttggatggatgtccctggggacaaactcttagagcct
gtggtttgcatgtcggacatgctgcggtctctggccaccacccggcccacggtgaatgca
gacgacctcctgaaagtgaagaaattctcagaggactttgggcaagagagttaa

KEGG   Homo sapiens (human): 9525
Entry
9525              CDS       T01001                                 
Symbol
VPS4B, MIG1, SKD1, SKD1B, VPS4-2
Name
(RefSeq) vacuolar protein sorting 4 homolog B
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    9525 (VPS4B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9525 (VPS4B)
  09143 Cell growth and death
   04217 Necroptosis
    9525 (VPS4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9525 (VPS4B)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    9525 (VPS4B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    9525 (VPS4B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    9525 (VPS4B)
SSDB
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 TIP49 AAA_16 AAA_22 RuvB_N AAA_5 IstB_IS21 AAA_14 AAA_18 AAA_2 DUF815 AAA_33 RNA_helicase AAA_17 AAA_24 PhoH AAA_7 Mg_chelatase NACHT DUF5906 bpMoxR Sigma54_activat TPR_1 MCM TPR_2
Other DBs
NCBI-GeneID: 9525
NCBI-ProteinID: NP_004860
OMIM: 609983
HGNC: 10895
Ensembl: ENSG00000119541
Pharos: O75351(Tbio)
UniProt: O75351 A0A024R2C5
Structure
LinkDB
Position
18:complement(63389190..63422476)
AA seq 444 aa
MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRA
KCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQL
QGAIVIERPNVKWSDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGK
SYLAKAVATEANNSTFFSISSSDLVSKWLGESEKLVKNLFQLARENKPSIIFIDEIDSLC
GSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPWVLDSAIRRRFEKRIYIPL
PEPHARAAMFKLHLGTTQNSLTEADFRELGRKTDGYSGADISIIVRDALMQPVRKVQSAT
HFKKVRGPSRADPNHLVDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSN
TKPTVNEHDLLKLKKFTEDFGQEG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtcatccacttcgcccaacctccagaaagcgatagatctggctagcaaagcagcgcaa
gaagacaaggctgggaactacgaagaagcccttcagctctatcagcatgctgtgcagtat
tttcttcatgtcgttaaatatgaagcacagggtgataaagccaagcaaagtatcagggca
aagtgtacagaatatcttgatagagcagaaaaactaaaggagtacctgaaaaataaagag
aaaaaagcacagaagccagtgaaagaaggacagccgagtccagcagatgagaaggggaat
gacagtgatggggaaggagaatctgatgatcctgaaaaaaagaaactacagaatcaactt
caaggtgccattgttatagaacgaccaaatgtgaaatggagtgacgttgctggacttgaa
ggagccaaagaagcactgaaagaggctgtgatactgcctattaaatttcctcatcttttt
acaggcaagagaacaccttggaggggaatcctattatttgggccgcctggaacaggaaag
tcctacttagccaaagctgtagcaacagaagccaacaactcaacatttttttcaatatct
tcctctgatcttgtttctaagtggctaggtgaaagtgaaaaactggttaagaatttattc
caacttgccagagagaacaagccctccattatcttcattgatgaaattgattctctctgt
ggttcaagaagtgaaaatgaaagtgaagccgcacgtagaattaagacggagttcctagtg
caaatgcaaggggttggtgtagacaatgatggaattttggttctgggagctacaaatata
ccctgggttctggattctgccattaggcgaagatttgagaaacgaatttatattcccttg
ccggaaccccatgcccgagcagcaatgtttaaactgcacctagggaccactcagaacagt
ctcacggaagcagactttcgggaacttgggaggaaaacagatggttattcaggggcagat
ataagtatcattgtacgtgatgcccttatgcagcctgttaggaaagtacagtcagctact
cattttaaaaaggttcgcggaccttcccgagctgatcctaaccatcttgtagatgatctg
ctaacaccttgctctccaggtgaccctggtgccattgaaatgacatggatggatgtccct
ggagataaacttttggagccagttgtttccatgtcggatatgttgcggtcactatctaac
acaaaacctacagtcaatgaacatgacttgttgaaattaaagaagtttacagaagatttt
ggtcaagaaggctaa

DBGET integrated database retrieval system