KEGG   Homo sapiens (human): 2797
Entry
2797              CDS       T01001                                 
Symbol
GNRH2, GnRH-II, LH-RHII
Name
(RefSeq) gonadotropin releasing hormone 2
  KO
K05252  gonadotropin-releasing hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04912  GnRH signaling pathway
hsa04929  GnRH secretion
Network
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06361  Hypogonadotropic hypogonadism
  Element
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00875  Mutation-inactivated GnRHR to GnRH-GnRHR-PLCB-PKC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2797 (GNRH2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    2797 (GNRH2)
   04912 GnRH signaling pathway
    2797 (GNRH2)
SSDB
Motif
Pfam: GnRH
Other DBs
NCBI-GeneID: 2797
NCBI-ProteinID: NP_001297149
OMIM: 602352
HGNC: 4420
Ensembl: ENSG00000125787
Pharos: O43555(Tbio)
CPD: C16084
UniProt: O43555
LinkDB
Position
20:3043622..3045747
AA seq 120 aa
MASSRRGLLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAG
SPVQTAHGLPSDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV
NT seq 363 nt   +upstreamnt  +downstreamnt
atggccagctccaggcgaggcctcctgctcctgctgctgctgactgcccaccttggaccc
tcagaggctcagcactggtcccatggctggtaccctggaggaaagcgagccctcagctca
gcccaggatccccagaatgcccttaggcccccaggaagggccctggacactgcagcaggc
agcccagtccagactgcccatggcctcccaagtgatgccctggctcccctggacgacagc
atgccctgggagggcaggaccacggcccagtggtcccttcacaggaagcgacacctggca
cggacactgctgaccgcagcccgagagccccgccccgccccgccatcctccaataaagtg
tga

DBGET integrated database retrieval system