KEGG   Homo sapiens (human): 282616
Entry
282616            CDS       T01001                                 
Symbol
IFNL2, IFNL2a, IFNL3a, IL-28A, IL28A
Name
(RefSeq) interferon lambda 2
  KO
K22669  interferon lambda 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    282616 (IFNL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282616 (IFNL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    282616 (IFNL2)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   282616 (IFNL2)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 282616
NCBI-ProteinID: NP_742150
OMIM: 607401
HGNC: 18364
Ensembl: ENSG00000183709
UniProt: Q8IZJ0
LinkDB
Position
19:39268396..39270188
AA seq 200 aa
MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALV
DVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTF
NLFRLLTRDLNCVASGDLCV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaactagacatgactggggactgcacgccagtgctggtgctgatggccgcagtgctg
accgtgactggagcagttcctgtcgccaggctccacggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacaggagctgcaggcctttaagagggcc
aaagatgccttagaagagtcgcttctgctgaaggactgcaggtgccactcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccatggctttggaggct
gagctggccctgacgctgaaggttctggaggccaccgctgacactgacccagccctggtg
gacgtcttggaccagccccttcacaccctgcaccatatcctctcccagttccgggcctgt
atccagcctcagcccacggcagggcccaggacccggggccgcctccaccattggctgtac
cggctccaggaggccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcacgcgagacctgaattgtgttgccagtggggacctgtgtgtc
tga

KEGG   Homo sapiens (human): 282617
Entry
282617            CDS       T01001                                 
Symbol
IFNL3, IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C
Name
(RefSeq) interferon lambda 3
  KO
K22669  interferon lambda 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    282617 (IFNL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282617 (IFNL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    282617 (IFNL3)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   282617 (IFNL3)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 282617
NCBI-ProteinID: NP_742151
OMIM: 607402
HGNC: 18365
Ensembl: ENSG00000197110
UniProt: Q8IZI9 A0A7R8C2Z6
Structure
LinkDB
Position
19:complement(39243455..39245250)
AA seq 196 aa
MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDAL
EESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLD
QPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFR
LLTRDLNCVASGDLCV
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaccggggactgcatgccagtgctggtgctgatggccgcagtgctgaccgtgactgga
gcagttcctgtcgccaggctccgcggggctctcccggatgcaaggggctgccacatagcc
cagttcaagtccctgtctccacaggagctgcaggcctttaagagggccaaagatgcctta
gaagagtcgcttctgctgaaggactgcaagtgccgctcccgcctcttccccaggacctgg
gacctgaggcagctgcaggtgagggagcgccccgtggctttggaggctgagctggccctg
acgctgaaggttctggaggccaccgctgacactgacccagccctgggggatgtcttggac
cagccccttcacaccctgcaccatatcctctcccagctccgggcctgtatccagcctcag
cccacggcagggcccaggacccggggccgcctccaccattggctgcaccggctccaggag
gccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttcaacctcttccgc
ctcctcacgcgagacctgaattgtgttgccagcggggacctgtgtgtctga

KEGG   Homo sapiens (human): 282618
Entry
282618            CDS       T01001                                 
Symbol
IFNL1, IL-29, IL29
Name
(RefSeq) interferon lambda 1
  KO
K05447  interferon lambda 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    282618 (IFNL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282618 (IFNL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    282618 (IFNL1)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   282618 (IFNL1)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 282618
NCBI-ProteinID: NP_742152
OMIM: 607403
HGNC: 18363
Ensembl: ENSG00000182393
UniProt: Q8IU54 A0A7R8C391
Structure
LinkDB
Position
19:39296407..39298673
AA seq 200 aa
MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEES
LKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHT
LHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRD
LKYVADGNLCLRTSTHPEST
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctgcagcttggaccgtggtgctggtgactttggtgctaggcttggccgtggcaggc
cctgtccccacttccaagcccaccacaactgggaagggctgccacattggcaggttcaaa
tctctgtcaccacaggagctagcgagcttcaagaaggccagggacgccttggaagagtca
ctcaagctgaaaaactggagttgcagctctcctgtcttccccgggaattgggacctgagg
cttctccaggtgagggagcgccctgtggccttggaggctgagctggccctgacgctgaag
gtcctggaggccgctgctggcccagccctggaggacgtcctagaccagccccttcacacc
ctgcaccacatcctctcccagctccaggcctgtatccagcctcagcccacagcagggccc
aggccccggggccgcctccaccactggctgcaccggctccaggaggcccccaaaaaggag
tccgctggctgcctggaggcatctgtcaccttcaacctcttccgcctcctcacgcgagac
ctcaaatatgtggccgatgggaacctgtgtctgagaacgtcaacccaccctgagtccacc
tga

KEGG   Homo sapiens (human): 338376
Entry
338376            CDS       T01001                                 
Symbol
IFNE, IFN-E, IFNE1, IFNT1, INFE1, PRO655
Name
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04622  RIG-I-like receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01558  Type I interferon to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    338376 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    338376 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    338376 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    338376 (IFNE)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   338376 (IFNE)
SSDB
Motif
Pfam: Interferon YutD-like
Other DBs
NCBI-GeneID: 338376
NCBI-ProteinID: NP_795372
OMIM: 615223
HGNC: 18163
Ensembl: ENSG00000184995
UniProt: Q86WN2 A0A7R8GUQ9
LinkDB
Position
9:complement(21480839..21482313)
AA seq 208 aa
MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNF
LLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYL
EALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVF
SLTEKLSKQGRPLNDMKQELTTEFRSPR
NT seq 627 nt   +upstreamnt  +downstreamnt
atgattatcaagcacttctttggaactgtgttggtgctgctggcctctaccactatcttc
tctctagatttgaaactgattatcttccagcaaagacaagtgaatcaagaaagtttaaaa
ctcttgaataagttgcaaaccttgtcaattcagcagtgtctaccacacaggaaaaacttt
ctgcttcctcagaagtctttgagtcctcagcagtaccaaaaaggacacactctggccatt
ctccatgagatgcttcagcagatcttcagcctcttcagggcaaatatttctctggatggt
tgggaggaaaaccacacggagaaattcctcattcaacttcatcaacagctagaataccta
gaagcactcatgggactggaagcagagaagctaagtggtactttgggtagtgataacctt
agattacaagttaaaatgtacttccgaaggatccatgattacctggaaaaccaggactac
agcacctgtgcctgggccattgtccaagtagaaatcagccgatgtctgttctttgtgttc
agtctcacagaaaaactgagcaaacaaggaagacccttgaacgacatgaagcaagagctt
actacagagtttagaagcccgaggtag

KEGG   Homo sapiens (human): 3439
Entry
3439              CDS       T01001                                 
Symbol
IFNA1, IFL, IFN, IFN-ALPHA, IFN-alphaD, IFNA13, IFNA@, leIF_D
Name
(RefSeq) interferon alpha 1
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06182  Shigella
nt06219  JAK-STAT signaling (cancer)
nt06222  IFN signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06517  TLR signaling
nt06518  JAK-STAT signaling
nt06519  RLR signaling
nt06520  CGAS-STING signaling
nt06527  Necroptosis
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
N01543  TLR7/8/9-IRF5 signaling pathway
N01558  Type I interferon to Jak-STAT signaling pathway
N01559  Type II interferon to Jak-STAT signaling pathway
N01662  IFN-RIPK1/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3439 (IFNA1)
   04151 PI3K-Akt signaling pathway
    3439 (IFNA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3439 (IFNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3439 (IFNA1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3439 (IFNA1)
   04621 NOD-like receptor signaling pathway
    3439 (IFNA1)
   04622 RIG-I-like receptor signaling pathway
    3439 (IFNA1)
   04623 Cytosolic DNA-sensing pathway
    3439 (IFNA1)
   04650 Natural killer cell mediated cytotoxicity
    3439 (IFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3439 (IFNA1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3439 (IFNA1)
   05161 Hepatitis B
    3439 (IFNA1)
   05160 Hepatitis C
    3439 (IFNA1)
   05171 Coronavirus disease - COVID-19
    3439 (IFNA1)
   05164 Influenza A
    3439 (IFNA1)
   05162 Measles
    3439 (IFNA1)
   05168 Herpes simplex virus 1 infection
    3439 (IFNA1)
   05163 Human cytomegalovirus infection
    3439 (IFNA1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3439 (IFNA1)
   05169 Epstein-Barr virus infection
    3439 (IFNA1)
   05165 Human papillomavirus infection
    3439 (IFNA1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3439 (IFNA1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3439 (IFNA1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3439 (IFNA1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3439 (IFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3439 (IFNA1)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   3439 (IFNA1)
SSDB
Motif
Pfam: Interferon iSTAND
Other DBs
NCBI-GeneID: 3439
NCBI-ProteinID: NP_076918
OMIM: 147660
HGNC: 5417
Ensembl: ENSG00000197919
UniProt: P01562 L0N195
Structure
LinkDB
Position
9:21440439..21441316
AA seq 189 aa
MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFG
FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLE
ACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcctcgccctttgctttactgatggtcctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctccctgagacccacagcctggataacaggaggaccttgatgctc
ctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacatgactttgga
tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgcttgg
gatgaggacctcctagacaaattctgcaccgaactctaccagcagctgaatgacttggaa
gcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactccatc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Homo sapiens (human): 3440
Entry
3440              CDS       T01001                                 
Symbol
IFNA2, IFN-alpha-2, IFN-alphaA, IFNA, IFNA2B, leIF_A
Name
(RefSeq) interferon alpha 2
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06182  Shigella
nt06222  IFN signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06517  TLR signaling
nt06518  JAK-STAT signaling
nt06519  RLR signaling
nt06520  CGAS-STING signaling
nt06527  Necroptosis
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
N01543  TLR7/8/9-IRF5 signaling pathway
N01558  Type I interferon to Jak-STAT signaling pathway
N01559  Type II interferon to Jak-STAT signaling pathway
N01662  IFN-RIPK1/3 signaling pathway
Drug target
Nadofaragene firadenovec: D12531<US>
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3440 (IFNA2)
   04151 PI3K-Akt signaling pathway
    3440 (IFNA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3440 (IFNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3440 (IFNA2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3440 (IFNA2)
   04621 NOD-like receptor signaling pathway
    3440 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    3440 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    3440 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    3440 (IFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3440 (IFNA2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3440 (IFNA2)
   05161 Hepatitis B
    3440 (IFNA2)
   05160 Hepatitis C
    3440 (IFNA2)
   05171 Coronavirus disease - COVID-19
    3440 (IFNA2)
   05164 Influenza A
    3440 (IFNA2)
   05162 Measles
    3440 (IFNA2)
   05168 Herpes simplex virus 1 infection
    3440 (IFNA2)
   05163 Human cytomegalovirus infection
    3440 (IFNA2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3440 (IFNA2)
   05169 Epstein-Barr virus infection
    3440 (IFNA2)
   05165 Human papillomavirus infection
    3440 (IFNA2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3440 (IFNA2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3440 (IFNA2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3440 (IFNA2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3440 (IFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3440 (IFNA2)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   3440 (IFNA2)
SSDB
Motif
Pfam: Interferon iSTAND
Other DBs
NCBI-GeneID: 3440
NCBI-ProteinID: NP_000596
OMIM: 147562
HGNC: 5423
Ensembl: ENSG00000188379
UniProt: P01563 A0A7R8GUN5
Structure
LinkDB
Position
9:complement(21384255..21385398)
AA seq 188 aa
MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFG
FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA
CVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtggccctcctggtgctcagctgcaagtcaagctgc
tctgtgggctgtgatctgcctcaaacccacagcctgggtagcaggaggaccttgatgctc
ctggcacagatgaggagaatctctcttttctcctgcttgaaggacagacatgactttgga
tttccccaggaggagtttggcaaccagttccaaaaggctgaaaccatccctgtcctccat
gagatgatccagcagatcttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatacagggggtgggggtgacagagactcccctgatgaaggaggactccattctg
gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct
tgtgcctgggaggttgtcagagcagaaatcatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

KEGG   Homo sapiens (human): 3441
Entry
3441              CDS       T01001                                 
Symbol
IFNA4, IFN-alpha4a, INFA4
Name
(RefSeq) interferon alpha 4
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06182  Shigella
nt06222  IFN signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06517  TLR signaling
nt06518  JAK-STAT signaling
nt06519  RLR signaling
nt06520  CGAS-STING signaling
nt06527  Necroptosis
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
N01543  TLR7/8/9-IRF5 signaling pathway
N01558  Type I interferon to Jak-STAT signaling pathway
N01559  Type II interferon to Jak-STAT signaling pathway
N01662  IFN-RIPK1/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3441 (IFNA4)
   04151 PI3K-Akt signaling pathway
    3441 (IFNA4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3441 (IFNA4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3441 (IFNA4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3441 (IFNA4)
   04621 NOD-like receptor signaling pathway
    3441 (IFNA4)
   04622 RIG-I-like receptor signaling pathway
    3441 (IFNA4)
   04623 Cytosolic DNA-sensing pathway
    3441 (IFNA4)
   04650 Natural killer cell mediated cytotoxicity
    3441 (IFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3441 (IFNA4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3441 (IFNA4)
   05161 Hepatitis B
    3441 (IFNA4)
   05160 Hepatitis C
    3441 (IFNA4)
   05171 Coronavirus disease - COVID-19
    3441 (IFNA4)
   05164 Influenza A
    3441 (IFNA4)
   05162 Measles
    3441 (IFNA4)
   05168 Herpes simplex virus 1 infection
    3441 (IFNA4)
   05163 Human cytomegalovirus infection
    3441 (IFNA4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3441 (IFNA4)
   05169 Epstein-Barr virus infection
    3441 (IFNA4)
   05165 Human papillomavirus infection
    3441 (IFNA4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3441 (IFNA4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3441 (IFNA4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3441 (IFNA4)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3441 (IFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3441 (IFNA4)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   3441 (IFNA4)
SSDB
Motif
Pfam: Interferon iSTAND
Other DBs
NCBI-GeneID: 3441
NCBI-ProteinID: NP_066546
OMIM: 147564
HGNC: 5425
Ensembl: ENSG00000236637
UniProt: P05014
LinkDB
Position
9:complement(21186618..21187587)
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFG
FPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcatttctcctgcctgaaggacagacatgatttcgga
ttccccgaggaggagtttgatggccaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctcgttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Homo sapiens (human): 3442
Entry
3442              CDS       T01001                                 
Symbol
IFNA5, IFN-alpha-5, IFN-alphaG, INA5, INFA5, leIF_G
Name
(RefSeq) interferon alpha 5
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06182  Shigella
nt06222  IFN signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06517  TLR signaling
nt06518  JAK-STAT signaling
nt06519  RLR signaling
nt06520  CGAS-STING signaling
nt06527  Necroptosis
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
N01543  TLR7/8/9-IRF5 signaling pathway
N01558  Type I interferon to Jak-STAT signaling pathway
N01559  Type II interferon to Jak-STAT signaling pathway
N01662  IFN-RIPK1/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3442 (IFNA5)
   04151 PI3K-Akt signaling pathway
    3442 (IFNA5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3442 (IFNA5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3442 (IFNA5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3442 (IFNA5)
   04621 NOD-like receptor signaling pathway
    3442 (IFNA5)
   04622 RIG-I-like receptor signaling pathway
    3442 (IFNA5)
   04623 Cytosolic DNA-sensing pathway
    3442 (IFNA5)
   04650 Natural killer cell mediated cytotoxicity
    3442 (IFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3442 (IFNA5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3442 (IFNA5)
   05161 Hepatitis B
    3442 (IFNA5)
   05160 Hepatitis C
    3442 (IFNA5)
   05171 Coronavirus disease - COVID-19
    3442 (IFNA5)
   05164 Influenza A
    3442 (IFNA5)
   05162 Measles
    3442 (IFNA5)
   05168 Herpes simplex virus 1 infection
    3442 (IFNA5)
   05163 Human cytomegalovirus infection
    3442 (IFNA5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3442 (IFNA5)
   05169 Epstein-Barr virus infection
    3442 (IFNA5)
   05165 Human papillomavirus infection
    3442 (IFNA5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3442 (IFNA5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3442 (IFNA5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3442 (IFNA5)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3442 (IFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3442 (IFNA5)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   3442 (IFNA5)
SSDB
Motif
Pfam: Interferon iSTAND
Other DBs
NCBI-GeneID: 3442
NCBI-ProteinID: NP_002160
OMIM: 147565
HGNC: 5426
Ensembl: ENSG00000147873
UniProt: P01569 A0A7R8C382
LinkDB
Position
9:complement(21304326..21305313)
AA seq 189 aa
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLE
ACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSAN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttgttttactgatggccctggtggtgctcaactgcaagtcaatctgt
tctctgggctgtgatctgcctcagacccacagcctgagtaacaggaggactttgatgata
atggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
tttcctcaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctacttgg
gatgagacacttctagacaaattctacactgaactttaccagcagctgaatgacctggaa
gcctgtatgatgcaggaggttggagtggaagacactcctctgatgaatgtggactctatc
ctgactgtgagaaaatactttcaaagaatcaccctctatctgacagagaagaaatacagc
ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctctttatcagcaaac
ttgcaagaaagattaaggaggaaggaatga

KEGG   Homo sapiens (human): 3443
Entry
3443              CDS       T01001                                 
Symbol
IFNA6, IFN-alphaK
Name
(RefSeq) interferon alpha 6
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06182  Shigella
nt06222  IFN signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06517  TLR signaling
nt06518  JAK-STAT signaling
nt06519  RLR signaling
nt06520  CGAS-STING signaling
nt06527  Necroptosis
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
N01543  TLR7/8/9-IRF5 signaling pathway
N01558  Type I interferon to Jak-STAT signaling pathway
N01559  Type II interferon to Jak-STAT signaling pathway
N01662  IFN-RIPK1/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3443 (IFNA6)
   04151 PI3K-Akt signaling pathway
    3443 (IFNA6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3443 (IFNA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3443 (IFNA6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3443 (IFNA6)
   04621 NOD-like receptor signaling pathway
    3443 (IFNA6)
   04622 RIG-I-like receptor signaling pathway
    3443 (IFNA6)
   04623 Cytosolic DNA-sensing pathway
    3443 (IFNA6)
   04650 Natural killer cell mediated cytotoxicity
    3443 (IFNA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3443 (IFNA6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3443 (IFNA6)
   05161 Hepatitis B
    3443 (IFNA6)
   05160 Hepatitis C
    3443 (IFNA6)
   05171 Coronavirus disease - COVID-19
    3443 (IFNA6)
   05164 Influenza A
    3443 (IFNA6)
   05162 Measles
    3443 (IFNA6)
   05168 Herpes simplex virus 1 infection
    3443 (IFNA6)
   05163 Human cytomegalovirus infection
    3443 (IFNA6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3443 (IFNA6)
   05169 Epstein-Barr virus infection
    3443 (IFNA6)
   05165 Human papillomavirus infection
    3443 (IFNA6)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3443 (IFNA6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3443 (IFNA6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3443 (IFNA6)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3443 (IFNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3443 (IFNA6)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   3443 (IFNA6)
SSDB
Motif
Pfam: Interferon iSTAND CoV_NSP2_N Vac17
Other DBs
NCBI-GeneID: 3443
NCBI-ProteinID: NP_066282
OMIM: 147566
HGNC: 5427
Ensembl: ENSG00000120235
UniProt: P05013 A0A7R8C308
LinkDB
Position
9:complement(21350318..21350887)
AA seq 189 aa
MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFR
FPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLE
ACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctttgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctggactgtgatctgcctcagacccacagcctgggtcacaggaggaccatgatgctc
ctggcacaaatgaggagaatctctcttttctcctgtctgaaggacagacatgacttcaga
tttccccaggaggagtttgatggcaaccagttccagaaggctgaagccatctctgtcctc
catgaggtgattcagcagaccttcaacctcttcagcacaaaggactcatctgttgcttgg
gatgagaggcttctagacaaactctatactgaactttaccagcagctgaatgacctggaa
gcctgtgtgatgcaggaggtgtgggtgggagggactcccctgatgaatgaggactccatc
ctggctgtgagaaaatacttccaaagaatcactctctacctgacagagaaaaagtacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctcttcatcaagaaac
ttgcaagaaaggttaaggaggaaggaataa

KEGG   Homo sapiens (human): 3444
Entry
3444              CDS       T01001                                 
Symbol
IFNA7, IFN-alphaJ, IFNA-J
Name
(RefSeq) interferon alpha 7
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06182  Shigella
nt06222  IFN signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06517  TLR signaling
nt06518  JAK-STAT signaling
nt06519  RLR signaling
nt06520  CGAS-STING signaling
nt06527  Necroptosis
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
N01543  TLR7/8/9-IRF5 signaling pathway
N01558  Type I interferon to Jak-STAT signaling pathway
N01559  Type II interferon to Jak-STAT signaling pathway
N01662  IFN-RIPK1/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3444 (IFNA7)
   04151 PI3K-Akt signaling pathway
    3444 (IFNA7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3444 (IFNA7)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3444 (IFNA7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3444 (IFNA7)
   04621 NOD-like receptor signaling pathway
    3444 (IFNA7)
   04622 RIG-I-like receptor signaling pathway
    3444 (IFNA7)
   04623 Cytosolic DNA-sensing pathway
    3444 (IFNA7)
   04650 Natural killer cell mediated cytotoxicity
    3444 (IFNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3444 (IFNA7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3444 (IFNA7)
   05161 Hepatitis B
    3444 (IFNA7)
   05160 Hepatitis C
    3444 (IFNA7)
   05171 Coronavirus disease - COVID-19
    3444 (IFNA7)
   05164 Influenza A
    3444 (IFNA7)
   05162 Measles
    3444 (IFNA7)
   05168 Herpes simplex virus 1 infection
    3444 (IFNA7)
   05163 Human cytomegalovirus infection
    3444 (IFNA7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3444 (IFNA7)
   05169 Epstein-Barr virus infection
    3444 (IFNA7)
   05165 Human papillomavirus infection
    3444 (IFNA7)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3444 (IFNA7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3444 (IFNA7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3444 (IFNA7)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3444 (IFNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3444 (IFNA7)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interferons
   3444 (IFNA7)
SSDB
Motif
Pfam: Interferon iSTAND CoV_NSP2_N
Other DBs
NCBI-GeneID: 3444
NCBI-ProteinID: NP_066401
OMIM: 147567
HGNC: 5428
Ensembl: ENSG00000214042
UniProt: P01567 A0A7R8C383
LinkDB
Position
9:complement(21201469..21202205)
AA seq 189 aa
MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFR
FPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTN
LKKGLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcccggtccttttctttactgatggtcgtgctggtactcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgcgtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcttgaaggacagacatgaattcaga
ttcccagaggaggagtttgatggccaccagttccagaagactcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggacttcatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac
ttgaaaaaaggattaaggaggaaggattga

DBGET integrated database retrieval system