KEGG   Homo sapiens (human): 2829
Entry
2829              CDS       T01001                                 

Symbol
XCR1, CCXCR1, GPR5
Name
(RefSeq) X-C motif chemokine receptor 1
  KO
K04193  XC chemokine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01258  XCL to XCR1 signaling
N01260  KSHV vCCL2 to XCR1 signaling
N01261  KSHV vCCL3 to XCR1 signaling
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2829 (XCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2829 (XCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2829 (XCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2829 (XCR1)
   04050 Cytokine receptors [BR:hsa04050]
    2829 (XCR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   C Chemokine
    2829 (XCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  C Chemokine
   2829 (XCR1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 2829
NCBI-ProteinID: NP_001019815
OMIM: 600552
HGNC: 1625
Ensembl: ENSG00000173578
Vega: OTTHUMG00000133449
Pharos: P46094(Tbio)
UniProt: P46094 Q689E2 Q502V0
LinkDB
Position
3p21.31
AA seq 333 aa
MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYE
SLESLTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFL
TIMTIHRYLSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSEL
TWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGP
YNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH
VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggagtcctcaggcaacccagagagcaccacctttttttactatgaccttcagagccag
ccgtgtgagaaccaggcctgggtctttgctaccctcgccaccactgtcctatactgcctg
gtgtttctcctcagcctagtgggcaacagcctggtcctgtgggtcctggtgaagtatgag
agcctggagtccctcaccaacatcttcatcctcaacctgtgcctctcagacctggtgttc
gcctgcttgttgcctgtgtggatctccccataccactggggctgggtgctgggagacttc
ctctgcaaactcctcaatatgatcttctccatcagcctctacagcagcatcttcttcctg
accatcatgaccatccaccgctacctgtcggtagtgagccccctctccaccctgcgcgtc
cccaccctccgctgccgggtgctggtgaccatggctgtgtgggtagccagcatcctgtcc
tccatcctcgacaccatcttccacaaggtgctttcttcgggctgtgattattccgaactc
acgtggtacctcacctccgtctaccagcacaacctcttcttcctgctgtccctggggatt
atcctgttctgctacgtggagatcctcaggaccctgttccgctcacgctccaagcggcgc
caccgcacggtcaagctcatcttcgccatcgtggtggcctacttcctcagctggggtccc
tacaacttcaccctgtttctgcagacgctgtttcggacccagatcatccggagctgcgag
gccaaacagcagctagaatacgccctgctcatctgccgcaacctcgccttctcccactgc
tgctttaacccggtgctctatgtcttcgtgggggtcaagttccgcacacacctgaaacat
gttctccggcagttctggttctgccggctgcaggcacccagcccagcctcgatcccccac
tcccctggtgccttcgcctatgagggcgcctccttctactga

DBGET integrated database retrieval system