KEGG   Homo sapiens (human): 2875
Entry
2875              CDS       T01001                                 

Symbol
GPT, AAT1, ALT1, GPT1
Name
(RefSeq) glutamic--pyruvic transaminase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2875 (GPT)
   00220 Arginine biosynthesis
    2875 (GPT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    2875 (GPT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     2875 (GPT)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   2875 (GPT)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 2875
NCBI-ProteinID: NP_005300
OMIM: 138200
HGNC: 4552
Ensembl: ENSG00000167701
Vega: OTTHUMG00000165176
Pharos: P24298(Tbio)
UniProt: P24298
LinkDB
Position
8q24.3
AA seq 496 aa
MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL
GAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRT
GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVI
NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDL
VVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL
LEKLSRFHAKFTLEYS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggcctcgagcacaggtgaccggagccaggcggtgaggcatggactgagggcgaaggtg
ctgacgctggacggcatgaacccgcgtgtgcggagagtggagtacgcagtgcgtggcccc
atagtgcagcgagccttggagctggagcaggagctgcgccagggtgtgaagaagcctttc
accgaggtcatccgtgccaacatcggggacgcacaggctatggggcagaggcccatcacc
ttcctgcgccaggtcttggccctctgtgttaaccctgatcttctgagcagccccaacttc
cctgacgatgccaagaaaagggcggagcgcatcttgcaggcgtgtgggggccacagtctg
ggggcctacagcgtcagctccggcatccagctgatccgggaggacgtggcgcggtacatt
gagaggcgtgacggaggcatccctgcggaccccaacaacgtcttcctgtccacaggggcc
agcgatgccatcgtgacggtgctgaagctgctggtggccggcgagggccacacacgcacg
ggtgtgctcatccccatcccccagtacccactctactcggccacgctggcagagctgggc
gcagtgcaggtggattactacctggacgaggagcgtgcctgggcgctggacgtggccgag
cttcaccgtgcactgggccaggcgcgtgaccactgccgccctcgtgcgctctgtgtcatc
aaccctggcaaccccaccgggcaggtgcagacccgcgagtgcatcgaggccgtgatccgc
ttcgccttcgaagagcggctctttctgctggcggacgaggtgtaccaggacaacgtgtac
gccgcgggttcgcagttccactcattcaagaaggtgctcatggagatggggccgccctac
gccgggcagcaggagcttgcctccttccactccacctccaagggctacatgggcgagtgc
gggttccgcggcggctatgtggaggtggtgaacatggacgctgcagtgcagcagcagatg
ctgaagctgatgagtgtgcggctgtgcccgccggtgccaggacaggccctgctggacctg
gtggtcagcccgcccgcgcccaccgacccctcctttgcgcagttccaggctgagaagcag
gcagtgctggcagagctggcggccaaggccaagctcaccgagcaggtcttcaatgaggct
cctggcatcagctgcaacccagtgcagggcgccatgtactccttcccgcgcgtgcagctg
cccccgcgggcggtggagcgcgctcaggagctgggcctggcccccgatatgttcttctgc
ctgcgcctcctggaggagaccggcatctgcgtggtgccagggagcggctttgggcagcgg
gaaggcacctaccacttccggatgaccattctgccccccttggagaaactgcggctgctg
ctggagaagctgagcaggttccatgccaagttcaccctcgagtactcctga

KEGG   Homo sapiens (human): 84706
Entry
84706             CDS       T01001                                 

Symbol
GPT2, ALT2, GPT_2, MRT49, NEDSPM
Name
(RefSeq) glutamic--pyruvic transaminase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    84706 (GPT2)
   00220 Arginine biosynthesis
    84706 (GPT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    84706 (GPT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     84706 (GPT2)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   84706 (GPT2)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 84706
NCBI-ProteinID: NP_597700
OMIM: 138210
HGNC: 18062
Ensembl: ENSG00000166123
Vega: OTTHUMG00000132541
Pharos: Q8TD30(Tbio)
UniProt: Q8TD30 A0A024R6R2
LinkDB
Structure
PDB: 
3IHJ

Position
16q11.2
AA seq 523 aa
MQRAAALVRRGCGPRTPSSWGRSQSSAAAEASAVLKVRPERSRRERILTLESMNPQVKAV
EYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPN
LLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDN
IYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENC
WALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADE
VYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLH
PEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLT
EDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVP
GSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgcagcgggcggcggcgctggtccggcggggctgtggtccccggacccccagctcctgg
ggccgcagccagagcagcgcggccgccgaggcctcggcggtgctcaaggtgcggcccgag
cgcagccggcgcgagcgcatcctcacgctggagtccatgaacccgcaggtgaaggcggtg
gagtacgccgtgcggggacccatcgtgctcaaggccggcgagatcgagctcgagctgcag
cggggtatcaaaaagccattcacagaggtcatccgagccaacatcggggacgcccaggct
atggggcagcagccaatcaccttcctccggcaggtgatggcactatgcacctacccaaac
ctgctggacagccccagcttcccagaagatgctaagaaacgtgcccggcggatcctgcag
gcttgtggcgggaacagcctggggtcctacagtgctagccagggtgtcaactgcatccgt
gaagatgtggctgcctacatcaccaggagggatggcggtgtgcctgcggaccccgacaac
atctacctgaccacgggagctagtgacggcatttctacgatcctgaagatcctcgtctcc
gggggcggcaagtcacggacaggtgtgatgatccccatcccacaatatcccctctattca
gctgtcatctctgagctcgacgccatccaggtgaattactacctggacgaggagaactgc
tgggcgctgaatgtgaatgagctccggcgggcggtgcaggaggccaaagaccactgtgat
cctaaggtgctctgcataatcaaccctgggaaccccacaggccaggtacaaagcagaaag
tgcatagaagatgtgatccactttgcctgggaagagaagctctttctcctggctgatgag
gtgtaccaggacaacgtgtactctccagattgcagattccactccttcaagaaggtgctg
tacgagatggggcccgagtactccagcaacgtggagctcgcctccttccactccacctcc
aagggctacatgggcgagtgtggttacagaggaggctacatggaggtgatcaacctgcac
cctgagatcaagggccagctggtgaagctgctgtcggtgcgcctgtgccccccagtgtct
gggcaggccgccatggacattgtcgtgaaccccccggtggcaggagaggagtcctttgag
caattcagccgagagaaggagtcggtcctgggtaatctggccaaaaaagcaaagctgacg
gaagacctgtttaaccaagtcccaggaattcactgcaaccccttgcagggggccatgtac
gccttccctcggatcttcattcctgccaaagctgtggaggctgctcaggcccatcaaatg
gctccagacatgttctactgcatgaagctcctggaggagactggcatctgtgtcgtgccc
ggcagtggctttgggcagagggaaggcacttaccacttcaggatgactatcctccctcca
gtggagaagctgaaaacggtgctgcagaaggtgaaagacttccacatcaacttcctggag
aagtacgcgtga

DBGET integrated database retrieval system