KEGG   Homo sapiens (human): 2914
Entry
2914              CDS       T01001                                 
Symbol
GRM4, GPRC1D, MGLUR4, mGlu4
Name
(RefSeq) glutamate metabotropic receptor 4
  KO
K04607  metabotropic glutamate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2914 (GRM4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2914 (GRM4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2914 (GRM4)
  09157 Sensory system
   04742 Taste transduction
    2914 (GRM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2914 (GRM4)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   2914 (GRM4)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 HbpS-like
Other DBs
NCBI-GeneID: 2914
NCBI-ProteinID: NP_000832
OMIM: 604100
HGNC: 4596
Ensembl: ENSG00000124493
Vega: OTTHUMG00000014538
Pharos: Q14833(Tchem)
UniProt: Q14833 A1L4F9
Structure
LinkDB
Position
6:complement(34018643..34155622)
AA seq 912 aa
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
NT seq 2739 nt   +upstreamnt  +downstreamnt
atgcctgggaagagaggcttgggctggtggtgggcccggctgcccctttgcctgctcctc
agcctttacggcccctggatgccttcctccctgggaaagcccaaaggccaccctcacatg
aattccatccgcatagatggggacatcacactgggaggcctgttcccggtgcatggccgg
ggctcagagggcaagccctgtggagaacttaagaaggaaaagggcatccaccggctggag
gccatgctgttcgccctggatcgcatcaacaacgacccggacctgctgcctaacatcacg
ctgggcgcccgcattctggacacctgctccagggacacccatgccctcgagcagtcgctg
acctttgtgcaggcgctcatcgagaaggatggcacagaggtccgctgtggcagtggcggc
ccacccatcatcaccaagcctgaacgtgtggtgggtgtcatcggtgcttcagggagctcg
gtctccatcatggtggccaacatccttcgcctcttcaagataccccagatcagctacgcc
tccacagcgccagacctgagtgacaacagccgctacgacttcttctcccgcgtggtgccc
tcggacacgtaccaggcccaggccatggtggacatcgtccgtgccctcaagtggaactat
gtgtccacagtggcctcggagggcagctatggtgagagcggtgtggaggccttcatccag
aagtcccgtgaggacgggggcgtgtgcatcgcccagtcggtgaagataccacgggagccc
aaggcaggcgagttcgacaagatcatccgccgcctcctggagacttcgaacgccagggca
gtcatcatctttgccaacgaggatgacatcaggcgtgtgctggaggcagcacgaagggcc
aaccagacaggccatttcttctggatgggctctgacagctggggctccaagattgcacct
gtgctgcacctggaggaggtggctgagggtgctgtcacgatcctccccaagaggatgtcc
gtacgaggcttcgaccgctacttctccagccgcacgctggacaacaaccggcgcaacatc
tggtttgccgagttctgggaggacaacttccactgcaagctgagccgccacgccctcaag
aagggcagccacgtcaagaagtgcaccaaccgtgagcgaattgggcaggattcagcttat
gagcaggaggggaaggtgcagtttgtgatcgatgccgtgtacgccatgggccacgcgctg
cacgccatgcaccgtgacctgtgtcccggccgcgtggggctctgcccgcgcatggaccct
gtagatggcacccagctgcttaagtacatccgaaacgtcaacttctcaggcatcgcaggg
aaccctgtgaccttcaatgagaatggagatgcgcctgggcgctatgacatctaccaatac
cagctgcgcaacgattctgccgagtacaaggtcattggctcctggactgaccacctgcac
cttagaatagagcggatgcactggccggggagcgggcagcagctgccccgctccatctgc
agcctgccctgccaaccgggtgagcggaagaagacagtgaagggcatgccttgctgctgg
cactgcgagccttgcacagggtaccagtaccaggtggaccgctacacctgtaagacgtgt
ccctatgacatgcggcccacagagaaccgcacgggctgccggcccatccccatcatcaag
cttgagtggggctcgccctgggccgtgctgcccctcttcctggccgtggtgggcatcgct
gccacgttgttcgtggtgatcacctttgtgcgctacaacgacacgcccatcgtcaaggcc
tcgggccgtgaactgagctacgtgctgctggcaggcatcttcctgtgctatgccaccacc
ttcctcatgatcgctgagcccgaccttggcacctgctcgctgcgccgaatcttcctggga
ctagggatgagcatcagctatgcagccctgctcaccaagaccaaccgcatctaccgcatc
ttcgagcagggcaagcgctcggtcagtgccccacgcttcatcagccccgcctcacagctg
gccatcaccttcagcctcatctcgctgcagctgctgggcatctgtgtgtggtttgtggtg
gacccctcccactcggtggtggacttccaggaccagcggacactcgacccccgcttcgcc
aggggtgtgctcaagtgtgacatctcggacctgtcgctcatctgcctgctgggctacagc
atgctgctcatggtcacgtgcaccgtgtatgccatcaagacacgcggcgtgcccgagacc
ttcaatgaggccaagcccattggcttcaccatgtacaccacttgcatcgtctggctggcc
ttcatccccatcttctttggcacctcgcagtcggccgacaagctgtacatccagacgacg
acgctgacggtctcggtgagtctgagcgcctcggtgtccctgggaatgctctacatgccc
aaagtctacatcatcctcttccacccggagcagaacgtgcccaagcgcaagcgcagcctc
aaagccgtcgttacggcggccaccatgtccaacaagttcacgcagaagggcaacttccgg
cccaacggagaggccaagtctgagctctgcgagaaccttgaggccccagcgctggccacc
aaacagacttacgtcacttacaccaaccatgcaatctag

KEGG   Homo sapiens (human): 2916
Entry
2916              CDS       T01001                                 
Symbol
GRM6, CSNB1B, GPRC1F, MGLUR6, mGlu6
Name
(RefSeq) glutamate metabotropic receptor 6
  KO
K04608  metabotropic glutamate receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
Disease
H00787  Congenital stationary night blindness
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2916 (GRM6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2916 (GRM6)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2916 (GRM6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    2916 (GRM6)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2916 (GRM6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     2916 (GRM6)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   2916 (GRM6)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Other DBs
NCBI-GeneID: 2916
NCBI-ProteinID: NP_000834
OMIM: 604096
HGNC: 4598
Ensembl: ENSG00000113262
Vega: OTTHUMG00000130889
Pharos: O15303(Tbio)
UniProt: O15303
LinkDB
Position
5:complement(178978327..178995320)
AA seq 877 aa
MARPRRAREPLLVALLPLAWLAQAGLARAAGSVRLAGGLTLGGLFPVHARGAAGRACGQL
KKEQGVHRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGR
GDGDEVGVRCPGGVPPLRPAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPE
LSDSTRYDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREA
GGVCIAQSIKIPREPKPGEFSKVIRRLMETPNARGIIIFANEDDIRRVLEAARQANLTGH
FLWVGSDSWGAKTSPILSLEDVAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEF
WEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAVYAIAHALHSMHQ
ALCPGHTGLCPAMEPTDGRMLLQYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNG
SASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGVPCCWHC
EACDGYRFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLSWSSPWAAPPLLLAVLGIVAT
TTVVATFVRYNNTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPGAAVCAARRLFLGLG
TTLSYSALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFSLTSLQVVGMIAWLGARP
PHSVIDYEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFN
EAKPIGFTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKT
YVILFHPEQNVQKRKRSLKATSTVAAPPKGEDAEAHK
NT seq 2634 nt   +upstreamnt  +downstreamnt
atggcgcggccccggagagcccgggagccgctgctcgtggcgctgctgccgctggcgtgg
ctggcgcaggcgggcctggcgcgcgcggcgggctctgtgcgcctggcgggcggcctgacg
ctgggcggcctgttcccggtgcacgcgcggggcgcggcgggccgggcgtgcgggcagctg
aagaaggagcagggcgtgcaccggctggaggccatgctgtacgcgctggaccgcgtcaac
gccgaccccgagctgctgcccggcgtgcgcctgggcgcgcggctgctggacacctgctcg
cgggacacctacgcgctggagcaggcgctgagcttcgtgcaggcgctgatccgcggccgc
ggcgacggcgacgaggtgggcgtgcgctgcccgggaggcgtccctccgctgcgccccgcg
ccccccgagcgcgtcgtggccgtcgtgggcgcctcggccagctccgtctccatcatggtc
gccaacgtgctgcgcctgtttgcgataccccagatcagctatgcctccacagccccggag
ctcagcgactccacacgctatgacttcttctcccgggtggtgccacccgactcctaccag
gcgcaggccatggtggacatcgtgagggcactgggatggaactatgtgtccacgctggcc
tccgagggcaactatggcgaaagtggggttgaggccttcgttcagatctcccgagaggct
gggggggtctgtattgcccagtctatcaagattcccagggaaccaaagccaggagagttc
agcaaggtgatcaggagactcatggagacgcccaacgcccggggcatcatcatctttgcc
aatgaggatgacatcaggcgggtcctggaggcagctcgccaggccaacctgaccggccac
ttcctgtgggtcggctcagacagctggggagccaagacctcacccatcttgagcctggag
gacgtggccgttggggccatcaccatcctgcccaaaagggcctccatcgacggatttgac
cagtacttcatgactcgatccctggagaacaaccgcaggaacatctggttcgccgagttc
tgggaagagaattttaactgcaaactgaccagctcaggtacccagtcagacgattccacc
cgcaaatgcacaggcgaggaacgcatcggccgggactccacctacgagcaggagggcaag
gtgcagtttgtgattgatgcggtgtacgccattgcccacgccctccacagcatgcaccag
gcgctctgccctgggcacacaggcctgtgcccggcgatggaacccactgatgggcggatg
cttctgcagtacattcgagctgtccgcttcaatggcagcgcaggaacccctgtgatgttc
aacgagaacggagatgcgcccgggcggtacgacatcttccagtaccaggcgaccaatggc
agtgccagcagtggcgggtaccaggcagtgggccagtgggcagagaccctcagactggat
gtggaggccctgcagtggtctggcgacccccacgaggtgccctcgtctctgtgcagcctg
ccctgcgggccgggggagcggaagaagatggtgaagggcgtcccctgctgttggcactgc
gaggcctgtgacgggtaccgcttccaggtggacgagttcacatgcgaggcctgtcctggg
gacatgaggcccacgcccaaccacacgggctgccgccccacacctgtggtgcgcctgagc
tggtcctccccctgggcagccccgccgctcctcctggccgtgctgggcatcgtggccact
accacggtggtggccaccttcgtgcggtacaacaacacgcccatcgtccgggcctcgggc
cgagagctcagctacgtcctcctcaccggcatcttcctcatctacgccatcaccttcctc
atggtggctgagcctggggccgcggtctgtgccgcccgcaggctcttcctgggcctgggc
acgaccctcagctactctgccctgctcaccaagaccaaccgtatctaccgcatctttgag
cagggcaagcgctcggtcacaccccctcccttcatcagccccacctcacagctggtcatc
accttcagcctcacctccctgcaggtggtggggatgatagcatggctgggggcccggccc
ccacacagcgtgattgactatgaggaacagcggacggtggaccccgagcaggccagaggg
gtgctcaagtgcgacatgtcggatctgtctctcatcggctgcctgggctacagcctcctg
ctcatggtcacgtgcacagtgtacgccatcaaggcccgtggcgtgcccgagaccttcaac
gaggccaagcccatcggcttcaccatgtacaccacctgcatcatctggctggcattcgtg
cccatcttctttggcactgcccagtcagctgaaaagatctacatccagacaaccacgcta
accgtgtccttgagcctgagtgcctcggtgtccctcggcatgctctacgtacccaaaacc
tacgtcatcctcttccatccagagcagaatgtgcagaagcgaaagcggagcctcaaggcc
acctccacggtggcagccccacccaagggcgaggatgcagaggcccacaagtag

DBGET integrated database retrieval system