KEGG   Homo sapiens (human): 2914
Entry
2914              CDS       T01001                                 
Symbol
GRM4, GPRC1D, MGLUR4, mGlu4
Name
(RefSeq) glutamate metabotropic receptor 4
  KO
K04607  metabotropic glutamate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2914 (GRM4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2914 (GRM4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2914 (GRM4)
  09157 Sensory system
   04742 Taste transduction
    2914 (GRM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2914 (GRM4)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   2914 (GRM4)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 HbpS-like
Other DBs
NCBI-GeneID: 2914
NCBI-ProteinID: NP_000832
OMIM: 604100
HGNC: 4596
Ensembl: ENSG00000124493
Vega: OTTHUMG00000014538
Pharos: Q14833(Tchem)
UniProt: Q14833 A1L4F9
Structure
LinkDB
Position
6:complement(34018643..34155622)
AA seq 912 aa
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
NT seq 2739 nt   +upstreamnt  +downstreamnt
atgcctgggaagagaggcttgggctggtggtgggcccggctgcccctttgcctgctcctc
agcctttacggcccctggatgccttcctccctgggaaagcccaaaggccaccctcacatg
aattccatccgcatagatggggacatcacactgggaggcctgttcccggtgcatggccgg
ggctcagagggcaagccctgtggagaacttaagaaggaaaagggcatccaccggctggag
gccatgctgttcgccctggatcgcatcaacaacgacccggacctgctgcctaacatcacg
ctgggcgcccgcattctggacacctgctccagggacacccatgccctcgagcagtcgctg
acctttgtgcaggcgctcatcgagaaggatggcacagaggtccgctgtggcagtggcggc
ccacccatcatcaccaagcctgaacgtgtggtgggtgtcatcggtgcttcagggagctcg
gtctccatcatggtggccaacatccttcgcctcttcaagataccccagatcagctacgcc
tccacagcgccagacctgagtgacaacagccgctacgacttcttctcccgcgtggtgccc
tcggacacgtaccaggcccaggccatggtggacatcgtccgtgccctcaagtggaactat
gtgtccacagtggcctcggagggcagctatggtgagagcggtgtggaggccttcatccag
aagtcccgtgaggacgggggcgtgtgcatcgcccagtcggtgaagataccacgggagccc
aaggcaggcgagttcgacaagatcatccgccgcctcctggagacttcgaacgccagggca
gtcatcatctttgccaacgaggatgacatcaggcgtgtgctggaggcagcacgaagggcc
aaccagacaggccatttcttctggatgggctctgacagctggggctccaagattgcacct
gtgctgcacctggaggaggtggctgagggtgctgtcacgatcctccccaagaggatgtcc
gtacgaggcttcgaccgctacttctccagccgcacgctggacaacaaccggcgcaacatc
tggtttgccgagttctgggaggacaacttccactgcaagctgagccgccacgccctcaag
aagggcagccacgtcaagaagtgcaccaaccgtgagcgaattgggcaggattcagcttat
gagcaggaggggaaggtgcagtttgtgatcgatgccgtgtacgccatgggccacgcgctg
cacgccatgcaccgtgacctgtgtcccggccgcgtggggctctgcccgcgcatggaccct
gtagatggcacccagctgcttaagtacatccgaaacgtcaacttctcaggcatcgcaggg
aaccctgtgaccttcaatgagaatggagatgcgcctgggcgctatgacatctaccaatac
cagctgcgcaacgattctgccgagtacaaggtcattggctcctggactgaccacctgcac
cttagaatagagcggatgcactggccggggagcgggcagcagctgccccgctccatctgc
agcctgccctgccaaccgggtgagcggaagaagacagtgaagggcatgccttgctgctgg
cactgcgagccttgcacagggtaccagtaccaggtggaccgctacacctgtaagacgtgt
ccctatgacatgcggcccacagagaaccgcacgggctgccggcccatccccatcatcaag
cttgagtggggctcgccctgggccgtgctgcccctcttcctggccgtggtgggcatcgct
gccacgttgttcgtggtgatcacctttgtgcgctacaacgacacgcccatcgtcaaggcc
tcgggccgtgaactgagctacgtgctgctggcaggcatcttcctgtgctatgccaccacc
ttcctcatgatcgctgagcccgaccttggcacctgctcgctgcgccgaatcttcctggga
ctagggatgagcatcagctatgcagccctgctcaccaagaccaaccgcatctaccgcatc
ttcgagcagggcaagcgctcggtcagtgccccacgcttcatcagccccgcctcacagctg
gccatcaccttcagcctcatctcgctgcagctgctgggcatctgtgtgtggtttgtggtg
gacccctcccactcggtggtggacttccaggaccagcggacactcgacccccgcttcgcc
aggggtgtgctcaagtgtgacatctcggacctgtcgctcatctgcctgctgggctacagc
atgctgctcatggtcacgtgcaccgtgtatgccatcaagacacgcggcgtgcccgagacc
ttcaatgaggccaagcccattggcttcaccatgtacaccacttgcatcgtctggctggcc
ttcatccccatcttctttggcacctcgcagtcggccgacaagctgtacatccagacgacg
acgctgacggtctcggtgagtctgagcgcctcggtgtccctgggaatgctctacatgccc
aaagtctacatcatcctcttccacccggagcagaacgtgcccaagcgcaagcgcagcctc
aaagccgtcgttacggcggccaccatgtccaacaagttcacgcagaagggcaacttccgg
cccaacggagaggccaagtctgagctctgcgagaaccttgaggccccagcgctggccacc
aaacagacttacgtcacttacaccaaccatgcaatctag

KEGG   Homo sapiens (human): 2918
Entry
2918              CDS       T01001                                 
Symbol
GRM8, GLUR8, GPRC1H, MGLUR8, mGlu8
Name
(RefSeq) glutamate metabotropic receptor 8
  KO
K04610  metabotropic glutamate receptor 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2918 (GRM8)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2918 (GRM8)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2918 (GRM8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    2918 (GRM8)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2918 (GRM8)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     2918 (GRM8)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   2918 (GRM8)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Other DBs
NCBI-GeneID: 2918
NCBI-ProteinID: NP_000836
OMIM: 601116
HGNC: 4600
Ensembl: ENSG00000179603
Vega: OTTHUMG00000022888
Pharos: O00222(Tchem)
UniProt: O00222
Structure
LinkDB
Position
7:complement(126438598..127252941)
AA seq 908 aa
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggtatgcgagggaaagcgatcagcctcttgcccttgtttcttcctcttgaccgccaag
ttctactggatcctcacaatgatgcaaagaactcacagccaggagtatgcccattccata
cgggtggatggggacattattttggggggtctcttccctgtccacgcaaagggagagaga
ggggtgccttgtggggagctgaagaaggaaaaggggattcacagactggaggccatgctt
tatgcaattgaccagattaacaaggaccctgatctcctttccaacatcactctgggtgtc
cgcatcctcgacacgtgctctagggacacctatgctttggagcagtctctaacattcgtg
caggcattaatagagaaagatgcttcggatgtgaagtgtgctaatggagatccacccatt
ttcaccaagcccgacaagatttctggcgtcataggtgctgcagcaagctccgtgtccatc
atggttgctaacattttaagactttttaagatacctcaaatcagctatgcatccacagcc
ccagagctaagtgataacaccaggtatgactttttctctcgagtggttccgcctgactcc
taccaagcccaagccatggtggacatcgtgacagcactgggatggaattatgtttcgaca
ctggcttctgaggggaactatggtgagagcggtgtggaggccttcacccagatctcgagg
gagattggtggtgtttgcattgctcagtcacagaaaatcccacgtgaaccaagacctgga
gaatttgaaaaaattatcaaacgcctgctagaaacacctaatgctcgagcagtgattatg
tttgccaatgaggatgacatcaggaggatattggaagcagcaaaaaaactaaaccaaagt
gggcattttctctggattggctcagatagttggggatccaaaatagcacctgtctatcag
caagaggagattgcagaaggggctgtgacaattttgcccaaacgagcatcaattgatgga
tttgatcgatactttagaagccgaactcttgccaataatcgaagaaatgtgtggtttgca
gaattctgggaggagaattttggctgcaagttaggatcacatgggaaaaggaacagtcat
ataaagaaatgcacagggctggagcgaattgctcgggattcatcttatgaacaggaagga
aaggtccaatttgtaattgatgctgtatattccatggcttacgccctgcacaatatgcac
aaagatctctgccctggatacattggcctttgtccacgaatgagtaccattgatgggaaa
gagctacttggttatattcgggctgtaaattttaatggcagtgctggcactcctgtcact
tttaatgaaaacggagatgctcctggacgttatgatatcttccagtatcaaataaccaac
aaaagcacagagtacaaagtcatcggccactggaccaatcagcttcatctaaaagtggaa
gacatgcagtgggctcatagagaacatactcacccggcgtctgtctgcagcctgccgtgt
aagccaggggagaggaagaaaacggtgaaaggggtcccttgctgctggcactgtgaacgc
tgtgaaggttacaactaccaggtggatgagctgtcctgtgaactttgccctctggatcag
agacccaacatgaaccgcacaggctgccagcttatccccatcatcaaattggagtggcat
tctccctgggctgtggtgcctgtgtttgttgcaatattgggaatcatcgccaccaccttt
gtgatcgtgacctttgtccgctataatgacacacctatcgtgagggcttcaggacgcgaa
cttagttacgtgctcctaacggggatttttctctgttattcaatcacgtttttaatgatt
gcagcaccagatacaatcatatgctccttccgacgggtcttcctaggacttggcatgtgt
ttcagctatgcagcccttctgaccaaaacaaaccgtatccaccgaatatttgagcagggg
aagaaatctgtcacagcgcccaagttcattagtccagcatctcagctggtgatcaccttc
agcctcatctccgtccagctccttggagtgtttgtctggtttgttgtggatcccccccac
atcatcattgactatggagagcagcggacactagatccagagaaggccaggggagtgctc
aagtgtgacatttctgatctctcactcatttgttcacttggatacagtatcctcttgatg
gtcacttgtactgtttatgccattaaaacgagaggtgtcccagagactttcaatgaagcc
aaacctattggatttaccatgtataccacctgcatcatttggttagctttcatccccatc
ttttttggtacagcccagtcagcagaaaagatgtacatccagacaacaacacttactgtc
tccatgagtttaagtgcttcagtatctctgggcatgctctatatgcccaaggtttatatt
ataatttttcatccagaacagaatgttcaaaaacgcaagaggagcttcaaggctgtggtg
acagctgccaccatgcaaagcaaactgatccaaaaaggaaatgacagaccaaatggcgag
gtgaaaagtgaactctgtgagagtcttgaaaccaacacttcctctaccaagacaacatat
atcagttacagcaatcattcaatctga

DBGET integrated database retrieval system