KEGG   Homo sapiens (human): 2919
Entry
2919              CDS       T01001                                 
Symbol
CXCL1, FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1
Name
(RefSeq) C-X-C motif chemokine ligand 1
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04936  Alcoholic liver disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01233  CXCL1/5/6/8 to CXCR1 signaling
N01234  CXCL1/5/8 to KSHV vGPCR signaling
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    2919 (CXCL1)
   04668 TNF signaling pathway
    2919 (CXCL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2919 (CXCL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2919 (CXCL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2919 (CXCL1)
   04657 IL-17 signaling pathway
    2919 (CXCL1)
   04062 Chemokine signaling pathway
    2919 (CXCL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2919 (CXCL1)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2919 (CXCL1)
   05134 Legionellosis
    2919 (CXCL1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2919 (CXCL1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    2919 (CXCL1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    2919 (CXCL1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    2919 (CXCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2919 (CXCL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2919 (CXCL1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 2919
NCBI-ProteinID: NP_001502
OMIM: 155730
HGNC: 4602
Ensembl: ENSG00000163739
Pharos: P09341(Tbio)
UniProt: P09341
Structure
LinkDB
Position
4:73869393..73871308
AA seq 107 aa
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcccgcgctgctctctccgccgcccccagcaatccccggctcctgcgagtggcactg
ctgctcctgctcctggtagccgctggccggcgcgcagcaggagcgtccgtggccactgaa
ctgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaacatccaaagtgtg
aacgtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggcggaaagcttgcctcaatcctgcatcccccatagttaagaaaatcatcgaaaagatg
ctgaacagtgacaaatccaactga

KEGG   Homo sapiens (human): 2920
Entry
2920              CDS       T01001                                 
Symbol
CXCL2, CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2
Name
(RefSeq) C-X-C motif chemokine ligand 2
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04936  Alcoholic liver disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
N01239  CXCL2/3/7 to KSHV vGPCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    2920 (CXCL2)
   04668 TNF signaling pathway
    2920 (CXCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2920 (CXCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2920 (CXCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2920 (CXCL2)
   04657 IL-17 signaling pathway
    2920 (CXCL2)
   04062 Chemokine signaling pathway
    2920 (CXCL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2920 (CXCL2)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2920 (CXCL2)
   05134 Legionellosis
    2920 (CXCL2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2920 (CXCL2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    2920 (CXCL2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    2920 (CXCL2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    2920 (CXCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2920 (CXCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2920 (CXCL2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 2920
NCBI-ProteinID: NP_002080
OMIM: 139110
HGNC: 4603
Ensembl: ENSG00000081041
Pharos: P19875(Tbio)
UniProt: P19875 A0A024RDD9
Structure
LinkDB
Position
4:complement(74097040..74099195)
AA seq 107 aa
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcccgcgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgcccctggccactgaa
ctgcgctgccagtgcttgcagaccctgcagggaattcacctcaagaacatccaaagtgtg
aaggtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggcagaaagcttgtctcaaccccgcatcgcccatggttaagaaaatcatcgaaaagatg
ctgaaaaatggcaaatccaactga

KEGG   Homo sapiens (human): 2921
Entry
2921              CDS       T01001                                 
Symbol
CXCL3, CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
Name
(RefSeq) C-X-C motif chemokine ligand 3
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04936  Alcoholic liver disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
N01239  CXCL2/3/7 to KSHV vGPCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    2921 (CXCL3)
   04668 TNF signaling pathway
    2921 (CXCL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2921 (CXCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2921 (CXCL3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2921 (CXCL3)
   04657 IL-17 signaling pathway
    2921 (CXCL3)
   04062 Chemokine signaling pathway
    2921 (CXCL3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2921 (CXCL3)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2921 (CXCL3)
   05134 Legionellosis
    2921 (CXCL3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2921 (CXCL3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    2921 (CXCL3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    2921 (CXCL3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    2921 (CXCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2921 (CXCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2921 (CXCL3)
SSDB
Motif
Pfam: IL8 Lenti_VIF_2
Other DBs
NCBI-GeneID: 2921
NCBI-ProteinID: NP_002081
OMIM: 139111
HGNC: 4604
Ensembl: ENSG00000163734
Pharos: P19876(Tbio)
UniProt: P19876
LinkDB
Position
4:complement(74036589..74038689)
AA seq 107 aa
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcccacgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgtccgtggtcactgaa
ctgcgctgccagtgcttgcagacactgcagggaattcacctcaagaacatccaaagtgtg
aatgtaaggtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggaagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcgaaaagata
ctgaacaaggggagcaccaactga

KEGG   Homo sapiens (human): 3576
Entry
3576              CDS       T01001                                 
Symbol
CXCL8, GCP-1, GCP1, IL8, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1, SCYB8
Name
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04936  Alcoholic liver disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05219  Bladder cancer
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06140  Transcription (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06224  CXCR signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
  Element
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N01233  CXCL1/5/6/8 to CXCR1 signaling
N01234  CXCL1/5/8 to KSHV vGPCR signaling
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    3576 (CXCL8)
   04072 Phospholipase D signaling pathway
    3576 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3576 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3576 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3576 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3576 (CXCL8)
   04621 NOD-like receptor signaling pathway
    3576 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    3576 (CXCL8)
   04657 IL-17 signaling pathway
    3576 (CXCL8)
   04062 Chemokine signaling pathway
    3576 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3576 (CXCL8)
   05202 Transcriptional misregulation in cancer
    3576 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    3576 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    3576 (CXCL8)
   05171 Coronavirus disease - COVID-19
    3576 (CXCL8)
   05164 Influenza A
    3576 (CXCL8)
   05163 Human cytomegalovirus infection
    3576 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3576 (CXCL8)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3576 (CXCL8)
   05130 Pathogenic Escherichia coli infection
    3576 (CXCL8)
   05132 Salmonella infection
    3576 (CXCL8)
   05131 Shigellosis
    3576 (CXCL8)
   05135 Yersinia infection
    3576 (CXCL8)
   05133 Pertussis
    3576 (CXCL8)
   05134 Legionellosis
    3576 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3576 (CXCL8)
   05144 Malaria
    3576 (CXCL8)
   05142 Chagas disease
    3576 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3576 (CXCL8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3576 (CXCL8)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3576 (CXCL8)
   04932 Non-alcoholic fatty liver disease
    3576 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3576 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3576 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3576 (CXCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   3576 (CXCL8)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   3576 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 3576
NCBI-ProteinID: NP_000575
OMIM: 146930
HGNC: 6025
Ensembl: ENSG00000169429
Pharos: P10145(Tchem)
UniProt: P10145 A0A024RDA5
Structure
LinkDB
Position
4:73740569..73743716
AA seq 99 aa
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
NT seq 300 nt   +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacatac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaacacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa

KEGG   Homo sapiens (human): 5473
Entry
5473              CDS       T01001                                 
Symbol
PPBP, B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1
Name
(RefSeq) pro-platelet basic protein
  KO
K10029  platelet basic protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
N01239  CXCL2/3/7 to KSHV vGPCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5473 (PPBP)
   04061 Viral protein interaction with cytokine and cytokine receptor
    5473 (PPBP)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    5473 (PPBP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5473 (PPBP)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   5473 (PPBP)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 5473
NCBI-ProteinID: NP_002695
OMIM: 121010
HGNC: 9240
Ensembl: ENSG00000163736
Pharos: P02775(Tbio)
UniProt: P02775
Structure
LinkDB
Position
4:complement(73986439..73988190)
AA seq 128 aa
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAE
LRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKK
LAGDESAD
NT seq 387 nt   +upstreamnt  +downstreamnt
atgagcctcagacttgataccaccccttcctgtaacagtgcgagaccacttcatgccttg
caggtgctgctgcttctgtcattgctgctgactgctctggcttcctccaccaaaggacaa
actaagagaaacttggcgaaaggcaaagaggaaagtctagacagtgacttgtatgctgaa
ctccgctgcatgtgtataaagacaacctctggaattcatcccaaaaacatccaaagtttg
gaagtgatcgggaaaggaacccattgcaaccaagtcgaagtgatagccacactgaaggat
gggaggaaaatctgcctggacccagatgctcccagaatcaagaaaattgtacagaaaaaa
ttggcaggtgatgaatctgctgattaa

KEGG   Homo sapiens (human): 6372
Entry
6372              CDS       T01001                                 
Symbol
CXCL6, CKA-3, GCP-2, GCP2, SCYB6
Name
(RefSeq) C-X-C motif chemokine ligand 6
  KO
K05506  C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05133  Pertussis
hsa05323  Rheumatoid arthritis
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01233  CXCL1/5/6/8 to CXCR1 signaling
N01235  CXCL6 to KSHV vGPCR signaling
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6372 (CXCL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6372 (CXCL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6372 (CXCL6)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6372 (CXCL6)
   04062 Chemokine signaling pathway
    6372 (CXCL6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    6372 (CXCL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6372 (CXCL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6372 (CXCL6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6372 (CXCL6)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6372
NCBI-ProteinID: NP_002984
OMIM: 138965
HGNC: 10643
Ensembl: ENSG00000124875
Pharos: P80162(Tbio)
UniProt: P80162
LinkDB
Position
4:73836678..73838760
AA seq 114 aa
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagcctcccgtccagccgcgcggcccgtgtcccgggtccttcgggctccttgtgcgcg
ctgctcgcgctgctgctcctgctgacgccgccggggcccctcgccagcgctggtcctgtc
tctgctgtgctgacagagctgcgttgcacttgtttacgcgttacgctgagagtaaacccc
aaaacgattggtaaactgcaggtgttccccgcaggcccgcagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaagcaagtttgtctggacccggaagccccttttctaaag
aaagtcatccagaaaattttggacagtggaaacaagaaaaactga

KEGG   Homo sapiens (human): 6374
Entry
6374              CDS       T01001                                 
Symbol
CXCL5, ENA-78, SCYB5
Name
(RefSeq) C-X-C motif chemokine ligand 5
  KO
K05506  C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05133  Pertussis
hsa05323  Rheumatoid arthritis
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01233  CXCL1/5/6/8 to CXCR1 signaling
N01234  CXCL1/5/8 to KSHV vGPCR signaling
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6374 (CXCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6374 (CXCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6374 (CXCL5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6374 (CXCL5)
   04062 Chemokine signaling pathway
    6374 (CXCL5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    6374 (CXCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6374 (CXCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6374 (CXCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6374 (CXCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6374
NCBI-ProteinID: NP_002985
OMIM: 600324
HGNC: 10642
Ensembl: ENSG00000163735
Pharos: P42830(Tbio)
UniProt: P42830 Q6I9S7
Structure
LinkDB
Position
4:complement(73995642..73998677)
AA seq 114 aa
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagcctcctgtccagccgcgcggcccgtgtccccggtccttcgagctccttgtgcgcg
ctgttggtgctgctgctgctgctgacgcagccagggcccatcgccagcgctggtcctgcc
gctgctgtgttgagagagctgcgttgcgtttgtttacagaccacgcaaggagttcatccc
aaaatgatcagtaatctgcaagtgttcgccataggcccacagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaaggaaatttgtcttgatccagaagccccttttctaaag
aaagtcatccagaaaattttggacggtggaaacaaggaaaactga

DBGET integrated database retrieval system