KEGG   Homo sapiens (human): 29934
Entry
29934             CDS       T01001                                 
Symbol
SNX12
Name
(RefSeq) sorting nexin 12
  KO
K17918  sorting nexin-3/12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29934 (SNX12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    29934 (SNX12)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   29934 (SNX12)
SSDB
Motif
Pfam: PX
Other DBs
NCBI-GeneID: 29934
NCBI-ProteinID: NP_001243114
OMIM: 300883
HGNC: 14976
Ensembl: ENSG00000147164
Pharos: Q9UMY4(Tbio)
UniProt: Q9UMY4 Q3SYF1
Structure
LinkDB
Position
X:complement(71059247..71073426)
AA seq 162 aa
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPI
FKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERR
QGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgtcggacacggcagtagctgatacccggcgccttaactcgaagccgcaggacctgacc
gacgcttacgggccgccaagtaacttcctggagatcgacatctttaatcctcagacggtg
ggcgtgggacgcgcgcgcttcaccacctatgaggttcgcatgcggacaaacctacctatc
ttcaagctaaaggagtcctgcgtacggcggcgctacagtgactttgagtggctgaaaaat
gagctggagagagatagcaagattgtagtaccaccactgcctgggaaagccttgaagcgg
cagctccctttccgaggagatgaagggatctttgaggagtctttcatcgaagaaaggagg
cagggcctcgagcagtttattaacaaaattgctgggcacccactggctcagaatgaacgc
tgcctacacatgttcctgcaagaggaggcaattgacaggaactacgtcccggggaaggtg
cgccagtag

KEGG   Homo sapiens (human): 8724
Entry
8724              CDS       T01001                                 
Symbol
SNX3, Grd19, MCOPS8, SDP3
Name
(RefSeq) sorting nexin 3
  KO
K17918  sorting nexin-3/12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8724 (SNX3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    8724 (SNX3)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   8724 (SNX3)
SSDB
Motif
Pfam: PX
Other DBs
NCBI-GeneID: 8724
NCBI-ProteinID: NP_003786
OMIM: 605930
HGNC: 11174
Ensembl: ENSG00000112335
Pharos: O60493(Tbio)
UniProt: O60493
Structure
LinkDB
Position
6:complement(108211222..108261040)
AA seq 162 aa
MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIF
KLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQ
GLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA
NT seq 489 nt   +upstreamnt  +downstreamnt
atggcggagaccgtggctgacacccggcggctgatcaccaagccgcagaacctgaatgac
gcctacggaccccccagcaacttcctcgagatcgatgtgagcaacccgcaaacggtgggg
gtcggccggggccgcttcaccacttacgaaatcagggtcaagacaaatcttcctattttc
aagctgaaagaatctactgttagaagaagatacagtgactttgaatggctgcgaagtgaa
ttagaaagagagagcaaggtcgtagttcccccgctccctgggaaagcgtttttgcgtcag
cttccttttagaggagatgatggaatatttgatgacaattttattgaggaaagaaaacaa
gggctggagcagtttataaacaaggtcgctggtcatcctctggcacagaacgaacgttgt
cttcacatgtttttacaagatgaaataatagataaaagctatactccatctaaaataaga
catgcctga

DBGET integrated database retrieval system