KEGG   Homo sapiens (human): 29935
Entry
29935             CDS       T01001                                 
Symbol
RPA4, HSU24186
Name
(RefSeq) replication protein A4
  KO
K10741  replication factor A4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Network
nt06502  Nucleotide excision repair
nt06506  Double-strand break repair
nt06508  Interstrand crosslink repair
  Element
N01431  Core NER reaction
N01446  DNA end resection and RPA loading
N01451  ATR signaling
N01452  Homologous recombination
N01466  Homologous recombination in ICLR
N01539  RAD51 -dsDNA destabilization
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    29935 (RPA4)
   03420 Nucleotide excision repair
    29935 (RPA4)
   03430 Mismatch repair
    29935 (RPA4)
   03440 Homologous recombination
    29935 (RPA4)
   03460 Fanconi anemia pathway
    29935 (RPA4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    29935 (RPA4)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    29935 (RPA4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    29935 (RPA4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     29935 (RPA4)
   MMR (mismatch excision repair)
     29935 (RPA4)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     29935 (RPA4)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 PolyA_pol
Other DBs
NCBI-GeneID: 29935
NCBI-ProteinID: NP_037479
OMIM: 300767
HGNC: 30305
Ensembl: ENSG00000204086
Pharos: Q13156(Tbio)
UniProt: Q13156
LinkDB
Position
X:96883908..96885467
AA seq 261 aa
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVF
DPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLS
VGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESV
PVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAID
YLTVEGHIYPTVDREHFKSAD
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagtaagagtgggtttgggagctatggcagcatttctgctgctgatggagcgagtgga
ggcagtgaccaactgtgtgagagagatgcaactcctgctattaagacccaaagacctaag
gtccgaattcaggacgttgtaccgtgtaatgtgaaccagcttctcagctctactgtgttt
gaccctgtgttcaaggttaggggaattatagtttcccaggtctccatcgtgggggtaatc
agaggggcagagaaggcttcaaatcacatttgttacaaaattgatgatatgaccgcgaaa
ccaatcgaggcccgacagtggtttggtagagagaaagtcaagcaggtgactccattgtca
gtcggagtatatgtcaaagtgtttggtatcctcaaatgtcccacgggaacaaagagcctt
gaggtattgaaaattcatgtcctagaggacatgaacgagttcaccgtgcatattctggaa
acggtcaatgcacacatgatgctggataaagcccgtcgtgataccactgtagaaagtgtg
cctgtgtctccatcagaagtgaatgatgctggggataacgatgagagtcaccgcaatttc
atccaggacgaagtgctgcgtttgattcatgagtgtcctcatcaggaagggaagagcatc
catgagctccgggctcagctctgcgaccttagcgtcaaggccatcaaggaagcgattgat
tatctgaccgttgagggccacatctatcccactgtggatcgggagcattttaagtctgct
gattga

KEGG   Homo sapiens (human): 6117
Entry
6117              CDS       T01001                                 
Symbol
RPA1, HSSB, MST075, PFBMFT6, REPA1, RF-A, RP-A, RPA70
Name
(RefSeq) replication protein A1
  KO
K07466  replication factor A1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Network
nt06502  Nucleotide excision repair
nt06503  Mismatch repair
nt06506  Double-strand break repair
nt06508  Interstrand crosslink repair
nt06509  DNA replication
  Element
N01431  Core NER reaction
N01432  Mismatch repair
N01446  DNA end resection and RPA loading
N01451  ATR signaling
N01452  Homologous recombination
N01466  Homologous recombination in ICLR
N01471  Origin unwinding and elongation
N01539  RAD51 -dsDNA destabilization
Disease
H02569  Pulmonary fibrosis and/or bone marrow failure, telomere-related
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    6117 (RPA1)
   03420 Nucleotide excision repair
    6117 (RPA1)
   03430 Mismatch repair
    6117 (RPA1)
   03440 Homologous recombination
    6117 (RPA1)
   03460 Fanconi anemia pathway
    6117 (RPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6117 (RPA1)
   03032 DNA replication proteins [BR:hsa03032]
    6117 (RPA1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6117 (RPA1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    6117 (RPA1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    6117 (RPA1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     6117 (RPA1)
   MMR (mismatch excision repair)
     6117 (RPA1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     6117 (RPA1)
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon IBR DUF223
Other DBs
NCBI-GeneID: 6117
NCBI-ProteinID: NP_002936
OMIM: 179835
HGNC: 10289
Ensembl: ENSG00000132383
Pharos: P27694(Tchem)
UniProt: P27694
Structure
LinkDB
Position
17:1830005..1900082
AA seq 616 aa
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLAT
QLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
GLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGT
QSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNE
QVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQF
DFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATL
WGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ
ALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQA
CPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAIL
GQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYR
EYGRRLVMSIRRSALM
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggtcggccaactgagcgagggggccattgcggccatcatgcagaagggggatacaaac
ataaagcccatcctccaagtcatcaacatccgtcccattactacggggaatagtccgccg
cgttatcgactgctcatgagtgatggattgaacactctatcctctttcatgttggcgaca
cagttgaaccctctcgtggaggaagaacaattgtccagcaactgtgtatgccagattcac
agatttattgtgaacactctgaaagacggaaggagagtagttatcttgatggaattagaa
gttttgaagtcagctgaagcagttggagtgaagattggcaatccagtgccctataatgaa
ggactcgggcagccgcaagtagctcctccagcgccagcagccagcccagcagcaagcagc
aggccccagccgcagaatggaagctcgggaatgggttctactgtttctaaggcttatggt
gcttcaaagacatttggaaaagctgcaggtcccagcctgtcacacacttctgggggaaca
cagtccaaagtggtgcccattgccagcctcactccttaccagtccaagtggaccatttgt
gctcgtgttaccaacaaaagtcagatccgtacctggagcaactcccgaggggaagggaag
cttttctccctagaactggttgacgaaagtggtgaaatccgagctacagctttcaatgag
caagtggacaagttctttcctcttattgaagtgaacaaggtgtattatttctcgaaaggc
accctgaagattgctaacaagcagttcacagctgttaaaaatgactacgagatgaccttc
aataacgagacttccgtcatgccctgtgaggacgaccatcatttacctacggttcagttt
gatttcacggggattgatgacctcgagaacaagtcgaaagactcacttgtagacatcatc
gggatctgcaagagctatgaagacgccactaaaatcacagtgaggtctaacaacagagaa
gttgccaagaggaatatctacttgatggacacatccgggaaggtggtgactgctacactg
tggggggaagatgctgataaatttgatggttctagacagcccgtgttggctatcaaagga
gcccgagtctctgatttcggtggacggagcctctccgtgctgtcttcaagcactatcatt
gcgaatcctgacatcccagaggcctataagcttcgtggatggtttgacgcagaaggacaa
gccttagatggtgtttccatctctgatctaaagagcggcggagtcggagggagtaacacc
aactggaaaaccttgtatgaggtcaaatccgagaacctgggccaaggcgacaagccggac
tactttagttctgtggccacagtggtgtatcttcgcaaagagaactgcatgtaccaagcc
tgcccgactcaggactgcaataagaaagtgattgatcaacagaatggattgtaccgctgt
gagaagtgcgacaccgaatttcccaatttcaagtaccgcatgatcctgtcagtaaatatt
gcagattttcaagagaatcagtgggtgacttgtttccaggagtctgctgaagctatcctt
ggacaaaatgctgcttatcttggggaattaaaagacaagaatgaacaggcatttgaagaa
gttttccagaatgccaacttccgatctttcatattcagagtcagggtcaaagtggagacc
tacaacgacgagtctcgaattaaggccactgtgatggacgtgaagcccgtggactacaga
gagtatggccgaaggctggtcatgagcatcaggagaagtgcattgatgtga

KEGG   Homo sapiens (human): 6118
Entry
6118              CDS       T01001                                 
Symbol
RPA2, REPA2, RP-A_p32, RP-A_p34, RPA32
Name
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Network
nt06502  Nucleotide excision repair
nt06503  Mismatch repair
nt06506  Double-strand break repair
nt06508  Interstrand crosslink repair
nt06509  DNA replication
  Element
N01431  Core NER reaction
N01432  Mismatch repair
N01446  DNA end resection and RPA loading
N01451  ATR signaling
N01452  Homologous recombination
N01466  Homologous recombination in ICLR
N01471  Origin unwinding and elongation
N01539  RAD51 -dsDNA destabilization
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    6118 (RPA2)
   03420 Nucleotide excision repair
    6118 (RPA2)
   03430 Mismatch repair
    6118 (RPA2)
   03440 Homologous recombination
    6118 (RPA2)
   03460 Fanconi anemia pathway
    6118 (RPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    6118 (RPA2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6118 (RPA2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    6118 (RPA2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     6118 (RPA2)
   MMR (mismatch excision repair)
     6118 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     6118 (RPA2)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon TFA2_Winged_2
Other DBs
NCBI-GeneID: 6118
NCBI-ProteinID: NP_002937
OMIM: 179836
HGNC: 10290
Ensembl: ENSG00000117748
Pharos: P15927(Tbio)
UniProt: P15927
Structure
LinkDB
Position
1:complement(27891524..27914797)
AA seq 270 aa
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtggaacagtggattcgaaagctatggcagctcctcatacgggggagccggcggctac
acgcagtccccggggggctttggatcgcccgcaccttctcaagccgaaaagaaatcaaga
gcccgagcccagcacattgtgccctgtactatatctcagctgctttctgccactttggtt
gatgaagtgttcagaattgggaatgttgagatttcacaggtcactattgtggggatcatc
agacatgcagagaaggctccaaccaacattgtttacaaaatagatgacatgacagctgca
cccatggacgttcgccagtgggttgacacagatgacaccagcagtgaaaacactgtggtt
cctccagaaacatatgtgaaagtggcaggccacctgagatcttttcagaacaaaaagagc
ctggtagcctttaagatcatgcccctggaggatatgaatgagttcaccacacatattctg
gaagtgatcaatgcacacatggtactaagcaaagccaacagccagccctcagcagggaga
gcacctatcagcaatccaggaatgagtgaagcagggaactttggtgggaatagcttcatg
ccagcaaatggcctcactgtggcccaaaaccaggtgttgaatttgattaaggcttgtcca
agacctgaagggttgaactttcaggatctcaagaaccagctgaaacacatgtctgtatcc
tcaatcaagcaagctgtggattttctgagcaatgaggggcacatctattctactgtggat
gatgaccattttaaatccacagatgcagaataa

KEGG   Homo sapiens (human): 6119
Entry
6119              CDS       T01001                                 
Symbol
RPA3, REPA3, RP-A_p14
Name
(RefSeq) replication protein A3
  KO
K10740  replication factor A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Network
nt06502  Nucleotide excision repair
nt06503  Mismatch repair
nt06506  Double-strand break repair
nt06508  Interstrand crosslink repair
nt06509  DNA replication
  Element
N01431  Core NER reaction
N01432  Mismatch repair
N01446  DNA end resection and RPA loading
N01451  ATR signaling
N01452  Homologous recombination
N01466  Homologous recombination in ICLR
N01471  Origin unwinding and elongation
N01539  RAD51 -dsDNA destabilization
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    6119 (RPA3)
   03420 Nucleotide excision repair
    6119 (RPA3)
   03430 Mismatch repair
    6119 (RPA3)
   03440 Homologous recombination
    6119 (RPA3)
   03460 Fanconi anemia pathway
    6119 (RPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    6119 (RPA3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6119 (RPA3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    6119 (RPA3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     6119 (RPA3)
   MMR (mismatch excision repair)
     6119 (RPA3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     6119 (RPA3)
SSDB
Motif
Pfam: Rep_fac-A_3
Other DBs
NCBI-GeneID: 6119
NCBI-ProteinID: NP_002938
OMIM: 179837
HGNC: 10291
Ensembl: ENSG00000106399
Pharos: P35244(Tbio)
UniProt: P35244 A4D105
Structure
LinkDB
Position
7:complement(7636518..7718607)
AA seq 121 aa
MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD
EEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQH
D
NT seq 366 nt   +upstreamnt  +downstreamnt
atggtggacatgatggacttgcccaggtcgcgcatcaacgccggcatgctagctcaattc
atcgacaagcctgtctgcttcgtagggaggctggaaaagattcatcccaccggaaaaatg
tttattctttcagatggagaaggaaaaaatggaaccatcgagttgatggaaccccttgat
gaagaaatctctggaattgtggaagtggttggaagagtaaccgccaaggccaccatcttg
tgtacatcttatgtccagtttaaagaagatagccatccttttgatcttggactttacaat
gaagctgtgaaaattatccatgacttccctcagttttatcctttagggattgtgcaacat
gattga

DBGET integrated database retrieval system