KEGG   Homo sapiens (human): 2995
Entry
2995              CDS       T01001                                 

Gene name
GYPC, CD236, CD236R, GE, GPC, GPD, GYPD, PAS-2, PAS-2'
Definition
(RefSeq) glycophorin C (Gerbich blood group)
  KO
K06576  glycophorin C
Organism
hsa  Homo sapiens (human)
Pathway
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    2995 (GYPC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2995 (GYPC)
CD molecules [BR:hsa04090]
 Proteins
  2995 (GYPC)
SSDB
Motif
Pfam: Syndecan Protocadherin Adeno_E3_CR2 RIFIN
Other DBs
NCBI-GeneID: 2995
NCBI-ProteinID: NP_002092
OMIM: 110750
HGNC: 4704
Ensembl: ENSG00000136732
Vega: OTTHUMG00000131464
Pharos: P04921(Tbio)
UniProt: P04921
LinkDB
Position
2q14.3
AA seq 128 aa
MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIV
VIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGD
SSRKEYFI
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtggtcgacgagaagccccaacagcacggcgtggcctctcagcctcgagcctgatccg
gggatggcctctgcctccaccacaatgcatactaccaccattgcagagcctgatccaggg
atgtctggatggccggatggcagaatggagacctccacccccaccataatggacattgtc
gtcattgcaggtgtgattgctgctgtggccatcgtcctagtctccctcctcttcgtcatg
ctgcgctacatgtaccggcacaagggcacgtaccacaccaatgaggccaagggcacggag
tttgctgagagtgcagatgcagccctgcagggagaccctgccctccaagatgctggtgat
agcagcagaaaggagtactttatttga

DBGET integrated database retrieval system