KEGG   Homo sapiens (human): 29990
Entry
29990             CDS       T01001                                 
Symbol
PILRB, FDFACT1, FDFACT2
Name
(RefSeq) paired immunoglobin like type 2 receptor beta
  KO
K15411  paired immunoglobulin-like type 2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    29990 (PILRB)
SSDB
Motif
Pfam: V-set I-set Ig_3 Ig_2
Other DBs
NCBI-GeneID: 29990
NCBI-ProteinID: NP_839956
OMIM: 605342
HGNC: 18297
Ensembl: ENSG00000121716
Pharos: Q9UKJ0(Tdark)
UniProt: Q9UKJ0
Structure
LinkDB
Position
7:100358117..100367831
AA seq 227 aa
MGRPLLLPLLLLLQPPAFLQPGGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWE
LAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQ
SVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSE
SWHLSLDTAIRVALAVAVLKTVILGLLCLLLLWWRRRKGSRAPSSDF
NT seq 684 nt   +upstreamnt  +downstreamnt
atgggtcggcccctgctgctgcccctgctgctcctgctgcagccgccagcatttctgcag
cctggtggctccacaggatctggtccaagctacctttatggggtcactcaaccaaaacac
ctctcagcctccatgggtggctctgtggaaatccccttctccttctattacccctgggag
ttagccatagttcccaacgtgagaatatcctggagacggggccacttccacgggcagtcc
ttctacagcacaaggccgccttccattcacaaggattatgtgaaccggctctttctgaac
tggacagagggtcaggagagcggcttcctcaggatctcaaacctgcggaaggaggaccag
tctgtgtatttctgccgagtcgagctggacacccggagatcagggaggcagcagttgcag
tccatcaaggggaccaaactcaccatcacccaggctgtcacaaccaccaccacctggagg
cccagcagcacaaccaccatagccggcctcagggtcacagaaagcaaagggcactcagaa
tcatggcacctaagtctggacactgccatcagggttgcattggctgtcgctgtgctcaaa
actgtcattttgggactgctgtgcctcctcctcctgtggtggaggagaaggaaaggtagc
agggcgccaagcagtgacttctga

KEGG   Homo sapiens (human): 29992
Entry
29992             CDS       T01001                                 
Symbol
PILRA, FDF03
Name
(RefSeq) paired immunoglobin like type 2 receptor alpha
  KO
K15411  paired immunoglobulin-like type 2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    29992 (PILRA)
SSDB
Motif
Pfam: V-set SCIMP MLANA G6B DUF6203 Ig_3 I-set DUF6479 SIT SKG6 RCR Ig_2 RIFIN DUF3306
Other DBs
NCBI-GeneID: 29992
NCBI-ProteinID: NP_038467
OMIM: 605341
HGNC: 20396
Ensembl: ENSG00000085514
Pharos: Q9UKJ1(Tbio)
UniProt: Q9UKJ1
Structure
LinkDB
Position
7:100371291..100400096
AA seq 303 aa
MGRPLLLPLLPLLLPPAFLQPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWE
LATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQ
SVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRV
TQGKRRSDSWHISLETAVGVAVAVTVLGIMILGLICLLRWRRRKGQQRTKATTPAREPFQ
NTEEPYENIRNEGQNTDPKLNPKDDGIVYASLALSSSTSPRAPPSHRPLKSPQNETLYSV
LKA
NT seq 912 nt   +upstreamnt  +downstreamnt
atgggtcggcccctgctgctgcccctactgcccttgctgctgccgccagcatttctgcag
cctagtggctccacaggatctggtccaagctacctttatggggtcactcaaccaaaacac
ctctcagcctccatgggtggctctgtggaaatccccttctccttctattacccctgggag
ttagccacagctcccgacgtgagaatatcctggagacggggccacttccacaggcagtcc
ttctacagcacaaggccgccttccattcacaaggattatgtgaaccggctctttctgaac
tggacagagggtcagaagagcggcttcctcaggatctccaacctgcagaagcaggaccag
tctgtgtatttctgccgagttgagctggacacacggagctcagggaggcagcagtggcag
tccatcgaggggaccaaactctccatcacccaggctgtcacgaccaccacccagaggccc
agcagcatgactaccacctggaggctcagtagcacaaccaccacaaccggcctcagggtc
acacagggcaaacgacgctcagactcttggcacataagtctggagactgctgtgggggtg
gcagtggctgtcactgtgctcggaatcatgattttgggactgatctgcctcctcaggtgg
aggagaaggaaaggtcagcagcggactaaagccacaaccccagccagggaacccttccaa
aacacagaggagccatatgagaatatcaggaatgaaggacaaaatacagatcccaagcta
aatcccaaggatgacggcatcgtctatgcttcccttgccctctccagctccacctcaccc
agagcacctcccagccaccgtcccctcaagagcccccagaacgagaccctgtactctgtc
ttaaaggcctaa

DBGET integrated database retrieval system