KEGG   Homo sapiens (human): 322
Entry
322               CDS       T01001                                 
Symbol
APBB1, FE65, MGC:9072, RIR
Name
(RefSeq) amyloid beta precursor protein binding family B member 1
  KO
K04529  amyloid beta A4 precursor protein-binding family B member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    322 (APBB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    322 (APBB1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    322 (APBB1)
SSDB
Motif
Pfam: PID WW PTB
Other DBs
NCBI-GeneID: 322
NCBI-ProteinID: NP_001155
OMIM: 602709
HGNC: 581
Ensembl: ENSG00000166313
Vega: OTTHUMG00000165454
Pharos: O00213(Tbio)
UniProt: O00213
Structure
LinkDB
Position
11:complement(6395124..6419453)
AA seq 710 aa
MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSEL
ELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLP
EPLESVEAPPRPQALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP
RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCH
VFRCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELV
QKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAV
LGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQK
CLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgtctgttccatcatcactgagccagtcggccattaatgccaacagccacggaggcccc
gcactgagcctacccctgcctctgcacgctgcccacaaccagctgctcaacgccaagctg
caggccacagctgtgggacccaaggacctgcgcagcgccatgggggagggtggtgggcct
gagccaggccctgccaatgccaagtggctaaaagagggccagaaccagctccggcgggcc
gccacggcccaccgtgaccagaatcgcaatgtgaccttgaccttggcggaggaggccagc
caggagcctgagatggcacccttgggccccaaaggcctgatacacctgtactctgagctg
gagctctcagctcacaacgcagccaaccgaggcctacgaggacctggcctgatcatcagc
actcaagagcaggggccagatgagggagaggagaaggcggccggggaggccgaggaggag
gaggaggatgatgatgatgaagaggaggaggaggacttatcttctcccccagggctgcct
gagcccctggagagtgtggaggcccctcccaggccccaagcccttacagatggcccccgg
gaacacagcaagagtgccagcctcctgtttggcatgcggaacagtgcagccagtgatgag
gactcaagctgggctaccttatcccagggcagcccctcctatggctccccagaggacaca
gattccttctggaaccccaacgccttcgagacggattccgacctgccggctggatggatg
agggtccaggacacctcagggacctattactggcacatcccaacagggaccacccagtgg
gaaccccccggccgggcctccccctcacaggggagcagcccccaagaggagtcccagctc
acctggacaggttttgctcatggagaaggctttgaggatggagaattttggaaggatgaa
cccagtgatgaggccccaatggagctgggactgaaggaacctgaggaggggacgttgacc
ttcccagctcagagcctcagcccagagccgttgccccaagaggaggagaagcttccccca
cggaataccaacccagggatcaagtgtttcgccgtgcgctccctaggctgggtagagatg
accgaggaggagctggcccctggacgcagcagtgtggcagtcaacaattgcatccgtcag
ctctcttaccacaaaaacaacctgcatgaccccatgtctgggggctggggggaaggaaag
gatctgctactgcagctggaggatgagacactaaagctagtggagccacagagccaggca
ctgctgcacgcccaacccatcatcagcatccgcgtgtggggcgtcgggcgggacagtgga
agagagagggactttgcctacgtagctcgtgataagctgacccagatgctcaagtgccac
gtgtttcgctgtgaggcacctgccaagaacatcgccaccagcctgcatgagatctgctct
aagatcatggccgaacggcgtaatgcccgctgcttggtaaatggactctccctggaccac
tctaaacttgtggatgtccctttccaagtggaattcccagcgcctaagaatgagttggtc
cagaagttccaagtctattacctggggaatgtacctgttgctaaacctgttggggtagat
gtgattaatggggccctcgagtcagtcctgtcctccagcagccgtgaacaatggacccca
agtcatgtcagtgtggcccctgctaccctcaccatcttgcaccagcagacagaggcagtg
ctgggagagtgtcgggtgcgtttcctctccttcctggccgtgggcagagatgtccacacg
tttgcattcatcatggctgccggcccagcctccttctgctgccacatgttctggtgcgag
cccaatgctgccagcctctcagaggctgtgcaggctgcgtgcatgcttcgctaccagaag
tgtctggatgcccgttcccaggcctccacctcctgcctcccagcaccccctgctgagtct
gtggcacggcgtgtagggtggactgtccgcaggggtgttcagtcgctgtggggctccctg
aagcccaaacggctgggggcccataccccatga

DBGET integrated database retrieval system