KEGG   Homo sapiens (human): 3250
Entry
3250              CDS       T01001                                 
Symbol
HPR, A-259H10.2, HP
Name
(RefSeq) haptoglobin-related protein
  KO
K14477  haptoglobin-related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    3250 (HPR)
SSDB
Motif
Pfam: Trypsin
Other DBs
NCBI-GeneID: 3250
NCBI-ProteinID: NP_066275
OMIM: 140210
HGNC: 5156
Ensembl: ENSG00000261701
Pharos: P00739(Tbio)
UniProt: P00739
LinkDB
Position
16:72063226..72077246
AA seq 348 aa
MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLR
TEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAK
MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVL
HPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKY
VMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSA
FAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgagtgacctgggagctgtcatttccctcctgctctggggacgacagctttttgcactg
tactcaggcaatgatgtcacggatatttcagatgaccgcttcccgaagccccctgagatt
gcaaatggctatgtggagcacttgtttcgctaccagtgtaagaactactacagactgcgc
acagaaggagatggagtatacaccttaaatgataagaagcagtggataaataaggctgtt
ggagataaacttcctgaatgtgaagcagtatgtgggaagcccaagaatccggcaaaccca
gtgcagcggatcctgggtggacacctggatgccaaaggcagctttccctggcaggctaag
atggtttcccaccataatctcaccacaggggccacgctgatcaatgaacaatggctgctg
accacggctaaaaatctcttcctgaaccattcagaaaatgcaacagcgaaagacattgcc
cctactttaacactctatgtggggaaaaagcagcttgtagagattgagaaggtggttcta
caccctaactaccaccaggtagatattgggctcatcaaactcaaacagaaggtgcttgtt
aatgagagagtgatgcccatctgcctaccttcaaagaattatgcagaagtagggcgtgtg
ggttacgtgtctggctggggacaaagtgacaactttaaacttactgaccatctgaagtat
gtcatgctgcctgtggctgaccaatacgattgcataacgcattatgaaggcagcacatgc
cccaaatggaaggcaccgaagagccctgtaggggtgcagcccatactgaacgaacacacc
ttctgtgtcggcatgtctaagtaccaggaagacacctgctatggcgatgcgggcagtgcc
tttgccgttcacgacctggaggaggacacctggtacgcggctgggatcctaagctttgat
aagagctgtgctgtggctgagtatggtgtgtatgtgaaggtgacttccatccagcactgg
gttcagaagaccatagctgagaactaa

DBGET integrated database retrieval system