KEGG   Homo sapiens (human): 338324
Entry
338324            CDS       T01001                                 
Symbol
S100A7A, NICE-2, NICE2, S100A15, S100A7L1, S100A7f
Name
(RefSeq) S100 calcium binding protein A7A
  KO
K21126  protein S100-A7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    338324 (S100A7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    338324 (S100A7A)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  S100 proteins
   338324 (S100A7A)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_6 EF-hand_7 p25-alpha EF-hand_5 Imm63
Other DBs
NCBI-GeneID: 338324
NCBI-ProteinID: NP_789793
OMIM: 617427
HGNC: 21657
Ensembl: ENSG00000184330
Vega: OTTHUMG00000013122
Pharos: Q86SG5(Tdark)
UniProt: Q86SG5
Structure
LinkDB
Position
1:153416520..153423222
AA seq 101 aa
MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFE
KKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
NT seq 306 nt   +upstreamnt  +downstreamnt
atgagcaacactcaagctgagaggtccataataggcatgatcgacatgtttcacaaatac
accggacgtgatggcaagattgagaagccaagcctgctgacgatgatgaaggagaacttc
cccaatttcctcagtgcctgtgacaaaaagggcatacattacctcgccactgtctttgag
aaaaaggacaagaatgaggataagaagattgatttttctgagtttctgtccttgctggga
gacatagccgcagactaccacaagcagagccatggagcggcgccctgttctgggggaagc
cagtga

KEGG   Homo sapiens (human): 6278
Entry
6278              CDS       T01001                                 
Symbol
S100A7, PSOR1, S100A7c
Name
(RefSeq) S100 calcium binding protein A7
  KO
K21126  protein S100-A7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6278 (S100A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    6278 (S100A7)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  S100 proteins
   6278 (S100A7)
SSDB
Motif
Pfam: S_100 EF-hand_1 p25-alpha EF-hand_7 EF-hand_6 DUF3770
Other DBs
NCBI-GeneID: 6278
NCBI-ProteinID: NP_002954
OMIM: 600353
HGNC: 10497
Ensembl: ENSG00000143556
Vega: OTTHUMG00000013123
Pharos: P31151(Tbio)
UniProt: P31151
Structure
LinkDB
Position
1:complement(153457744..153460651)
AA seq 101 aa
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFE
KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
NT seq 306 nt   +upstreamnt  +downstreamnt
atgagcaacactcaagctgagaggtccataataggcatgatcgacatgtttcacaaatac
accagacgtgatgacaagattgagaagccaagcctgctgacgatgatgaaggagaacttc
cccaacttccttagtgcctgtgacaaaaagggcacaaattacctcgccgatgtctttgag
aaaaaggacaagaatgaggataagaagattgatttttctgagtttctgtccttgctggga
gacatagccacagactaccacaagcagagccatggagcagcgccctgttccgggggcagc
cagtga

DBGET integrated database retrieval system