KEGG   Homo sapiens (human): 3434
Entry
3434              CDS       T01001                                 
Symbol
IFIT1, C56, G10P1, IFI-56, IFI-56K, IFI56, IFIT-1, IFNAI1, ISG56, P56, RNM561
Name
(RefSeq) interferon induced protein with tetratricopeptide repeats 1
  KO
K14217  interferon-induced protein with tetratricopeptide repeats 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    3434 (IFIT1)
SSDB
Motif
Pfam: TPR_2 TPR_12 TPR_8 TPR_19 TPR_1 TPR_14 TPR_11 TPR_7 TPR_17 TPR_16 TPR_10 ANAPC3 TPR_15 TPR_MalT TPR-S NatA_aux_su Sec16_C ANAPC5 DUF4268 DUF4919 Fis1_TPR_C
Other DBs
NCBI-GeneID: 3434
NCBI-ProteinID: NP_001539
OMIM: 147690
HGNC: 5407
Ensembl: ENSG00000185745
Vega: OTTHUMG00000018712
Pharos: P09914(Tbio)
UniProt: P09914
Structure
LinkDB
Position
10:89392623..89406487
AA seq 478 aa
MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAY
VKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDK
VENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAG
YAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYI
EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE
ENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagtacaaatggtgatgatcatcaggtcaaggatagtctggagcaattgagatgtcac
tttacatgggagttatccattgatgacgatgaaatgcctgatttagaaaacagagtcttg
gatcagattgaattcctagacaccaaatacagtgtgggaatacacaacctactagcctat
gtgaaacacctgaaaggccagaatgaggaagccctgaagagcttaaaagaagctgaaaac
ttaatgcaggaagaacatgacaaccaagcaaatgtgaggagtctggtgacctggggcaac
tttgcctggatgtattaccacatgggcagactggcagaagcccagacttacctggacaag
gtggagaacatttgcaagaagctttcaaatcccttccgctatagaatggagtgtccagaa
atagactgtgaggaaggatgggccttgctgaagtgtggaggaaaaaattatgaacgggcc
aaggcctgctttgaaaaggtgcttgaagtggaccctgaaaaccctgaatccagcgctggg
tatgcgatctctgcctatcgcctggatggctttaaattagccacaaaaaatcacaagcca
ttttctttgcttcccctaaggcaggctgtccgcttaaatccagacaatggatatattaag
gttctccttgccctgaagcttcaggatgaaggacaggaagctgaaggagaaaagtacatt
gaagaagctctagccaacatgtcctcacagacctatgtctttcgatatgcagccaagttt
taccgaagaaaaggctctgtggataaagctcttgagttattaaaaaaggccttgcaggaa
acacccacttctgtcttactgcatcaccagatagggctttgctacaaggcacaaatgatc
caaatcaaggaggctacaaaagggcagcctagagggcagaacagagaaaagctagacaaa
atgataagatcagccatatttcattttgaatctgcagtggaaaaaaagcccacatttgag
gtggctcatctagacctggcaagaatgtatatagaagcaggcaatcacagaaaagctgaa
gagaattttcaaaaattgttatgcatgaaaccagtggtagaagaaacaatgcaagacata
catttccactatggtcggtttcaggaatttcaaaagaaatctgacgtcaatgcaattatc
cattatttaaaagctataaaaatagaacaggcatcattaacaagggataaaagtatcaat
tctttgaagaaattggttttaaggaaacttcggagaaaggcattagatctggaaagcttg
agcctccttgggttcgtctacaaattggaaggaaatatgaatgaagccctggagtactat
gagcgggccctgagactggctgctgactttgagaactctgtgagacaaggtccttag

KEGG   Homo sapiens (human): 439996
Entry
439996            CDS       T01001                                 
Symbol
IFIT1B, IFIT1L, bA149I23.6
Name
(RefSeq) interferon induced protein with tetratricopeptide repeats 1B
  KO
K14217  interferon-induced protein with tetratricopeptide repeats 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    439996 (IFIT1B)
SSDB
Motif
Pfam: TPR_2 TPR_11 TPR_14 TPR_12 TPR_1 TPR_8 TPR_19 TPR_17 TPR_7 TPR_15 TPR_MalT TPR_10 ANAPC3 NatA_aux_su Sec16_C
Other DBs
NCBI-GeneID: 439996
NCBI-ProteinID: NP_001010987
HGNC: 23442
Ensembl: ENSG00000204010
Vega: OTTHUMG00000018709
Pharos: Q5T764(Tdark)
UniProt: Q5T764
LinkDB
Position
10:89378056..89385205
AA seq 474 aa
MSEESDGKLIEDSLIQLRCHFTWKLLIEAPEIPDLENRIWEEIQFLDTKYNVGIHNLLAY
VKHLKGQNEEALVSLKKAEDLIQKEHANQADIRSLVTWGNFAWVYYHMGRLAEAQTYLDK
VENTCKKFANPSRYRMECPEVDCEEGWALAKCGGKNYERAKTCFEKALEGNPENPEFNTG
YAITVYRLDKFNTASGRNKAFSLHVLKRAVRLNPDDVYIRVLLALKLQDEGQEAEGEKYI
EEALTSISSQAYVFQYAAKFYRRKGSVDKALELLKMALETTPTSAFLHHQMGLCYRAQMI
QIKEATNWQPRGQDRETVDRLVQLAICKFEKTIMLKRTFEMAYVDLAETYAEIGHHRKAE
EHFQKGLRMKIFEDQLKQEIHYHYGRFQEHHGKSQDKAITHYLKGLKIEKMSHSREKLLN
ALEKLAKRCIHQNVRVVESVSLLGLIHKLKGEVSDALLCYERALRLAADLNPIF
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgagtgaagaatctgatggaaagcttattgaagacagcctgattcagctgagatgtcac
tttacatggaagttgttaattgaagcccctgaaattcctgatttagaaaacaggatctgg
gaagagattcagttcctggacaccaaatacaatgtgggaatacacaacctactagcctat
gtgaaacacctgaaaggccagaatgaggaagccctggtcagcttgaaaaaggctgaagac
ttaattcagaaagaacatgccaaccaagcagatattagaagtctggtgacctggggcaac
tttgcctgggtgtattaccacatgggcagattggcagaagcccagacttacctggacaag
gtggagaacacttgcaagaagtttgcaaatccttcccgctatagaatggagtgtccagag
gtggactgtgaggaaggatgggccttggcgaagtgtggtggaaagaattatgaacgggcc
aagacctgctttgaaaaggctctggaagggaaccctgaaaaccctgaattcaatactggg
tacgcaatcaccgtctatcgcctggataaatttaacacagcatcagggaggaataaggca
ttttctctgcacgtcctaaaacgagctgtcaggctaaatccagatgatgtatatattagg
gttctccttgccctgaagcttcaggatgaaggacaggaagctgaaggagaaaagtacatt
gaagaagctctgaccagtatatcttcacaggcctatgtctttcaatatgcagccaagttt
tatcgaagaaaagggtctgtggataaagctcttgagctcttaaaaatggccttggagaca
acacccacttctgccttcctgcatcaccaaatggggctttgctacagggcacaaatgatc
caaatcaaggaagctacaaactggcagcctagagggcaagatagggaaactgtggacaga
ttggttcaattggctatatgcaaatttgaaaagactataatgttaaagcgaacatttgag
atggcctatgttgacctggctgaaacgtatgcagaaataggccaccacagaaaggctgag
gaacattttcagaaagggttacgcatgaagatctttgaagatcagctaaagcaagagatt
cattaccactacggccgtttccaagaacatcatgggaaatctcaagataaagcaattacc
cattatttaaaaggtttgaaaatagaaaaaatgtcccattccagggaaaaacttctcaat
gctttagagaaattggctaaaagatgtattcaccagaatgtacgggttgtggaaagtgtc
agcctccttgggcttatccacaaattgaaaggagaagtaagtgatgctttgctgtgctat
gagagggctctgaggctggctgctgacctgaaccctatattttaa

DBGET integrated database retrieval system