KEGG   Homo sapiens (human): 346606
Entry
346606            CDS       T01001                                 
Symbol
MOGAT3, DC7, DGAT2L2, MGAT3
Name
(RefSeq) monoacylglycerol O-acyltransferase 3
  KO
K14456  2-acylglycerol O-acyltransferase 3 [EC:2.3.1.20 2.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04975  Fat digestion and absorption
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    346606 (MOGAT3)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    346606 (MOGAT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     346606 (MOGAT3)
    2.3.1.22  2-acylglycerol O-acyltransferase
     346606 (MOGAT3)
SSDB
Motif
Pfam: DAGAT Acyltransferase
Other DBs
NCBI-GeneID: 346606
NCBI-ProteinID: NP_835470
OMIM: 610184
HGNC: 23249
Ensembl: ENSG00000106384
Pharos: Q86VF5(Tbio)
UniProt: Q86VF5
LinkDB
Position
7:complement(101192886..101201036)
AA seq 341 aa
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYL
VWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMC
TGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQ
PQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRL
KAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQR
LHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgggagttgccacaaccctgcagcccccaaccacttccaaaaccttgcagaagcagcat
ctagaagcagtgggcgcctaccaatatgtgctcactttcctcttcatgggccctttcttc
tcccttcttgtctttgtcctcctcttcacgtcactctggcccttctctgttttttacttg
gtgtggctctatgtggactgggacacacccaaccaaggtggaaggcgttcggagtggata
aggaaccgggcaatttggagacaactaagggattattatcctgtcaagctggtgaaaaca
gcagagctgcccccggatcggaactacgtgctgggcgcccaccctcatgggatcatgtgt
acaggcttcctctgtaatttctccaccgagagcaatggcttctcccagctcttcccgggg
ctccggccctggttagccgtgctggctggcctcttctacctcccggtctatcgcgactac
atcatgtcctttggactctgtccggtgagccgccagagcctggacttcatcctgtcccag
ccccagctcgggcaggccgtggtcatcatggtggggggtgcgcacgaggccctgtattca
gtccccggggagcactgccttacgctccagaagcgcaaaggcttcgtgcgcctggcgctg
aggcacggggcgtccctggtgcccgtgtactcctttggggagaatgacatctttagactt
aaggcttttgccacaggctcctggcagcattggtgccagctcaccttcaagaagctcatg
ggcttctctccttgcatcttctggggtcgcggtctcttctcagccacctcctggggcctg
ctgccctttgctgtgcccatcaccactgtggtgggccgccccatccccgtcccccagcgc
ctccaccccaccgaggaggaagtcaatcactatcacgccctctacatgacggccctggag
cagctcttcgaggagcacaaggaaagctgtggggtccccgcttccacctgcctcaccttc
atctag

KEGG   Homo sapiens (human): 80168
Entry
80168             CDS       T01001                                 
Symbol
MOGAT2, DGAT2L5, DGAT2L5., MGAT2, hDC5
Name
(RefSeq) monoacylglycerol O-acyltransferase 2
  KO
K14457  2-acylglycerol O-acyltransferase 2 [EC:2.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    80168 (MOGAT2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    80168 (MOGAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.22  2-acylglycerol O-acyltransferase
     80168 (MOGAT2)
SSDB
Motif
Pfam: DAGAT
Other DBs
NCBI-GeneID: 80168
NCBI-ProteinID: NP_079374
OMIM: 610270
HGNC: 23248
Ensembl: ENSG00000166391
Pharos: Q3SYC2(Tchem)
UniProt: Q3SYC2
LinkDB
Position
11:75717838..75732953
AA seq 334 aa
MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLD
RDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFAN
LCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNL
LGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSG
SWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEE
VNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggtagagttcgcgcccttgtttatgccgtgggagcgcaggctgcagacacttgctgtc
ctacagtttgtcttctccttcttggcactggccgagatctgcactgtgggcttcatagcc
ctcctgtttacaagattctggctcctcactgtcctgtatgcggcctggtggtatctggac
cgagacaagccacggcaggggggccggcacatccaggccatcaggtgctggactatatgg
aagtacatgaaggactatttccccatctcgctggtcaagactgctgagctggacccctct
cggaactacattgcgggcttccacccccatggagtcctggcagtcggagcctttgccaac
ctgtgcactgagagcacaggcttctcttcgatcttccccggtatccgcccccatctgatg
atgctgaccttgtggttccgggcccccttcttcagagattacatcatgtctgcagggttg
gtcacatcagaaaaggagagtgctgctcacattctgaacaggaagggtggcggaaacttg
ctgggcatcattgtagggggtgcccaggaggccctggatgccaggcctggatccttcacg
ctgttactgcggaaccgaaagggcttcgtcaggctcgccctgacacacggggcacccctg
gtgccaatcttctccttcggggagaatgacctatttgaccagattcccaactcttctggc
tcctggttacgctatatccagaatcggttgcagaagatcatgggcatctccctcccactc
tttcatggccgtggtgtcttccagtacagctttggtttaataccctaccgccggcccatc
accactgtggtggggaagcccatcgaggtacagaagacgctgcatccctcggaggaggag
gtgaaccagctgcaccagcgttatatcaaagagctgtgcaacctcttcgaggcccacaaa
cttaagttcaacatccctgctgaccagcacttggagttctgctga

DBGET integrated database retrieval system