KEGG   Homo sapiens (human): 3479
Entry
3479              CDS       T01001                                 
Symbol
IGF1, IGF, IGF-I, IGFI, MGF
Name
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04510  Focal adhesion
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04935  Growth hormone synthesis, secretion and action
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
Network
nt06114  PI3K signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06210  ERK signaling
nt06214  PI3K signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06324  GHRH-GH-IGF signaling
  Element
N00133  EWSR1-FLI1 fusion to transcriptional activation
N00135  EWSR1-ERG fusion to transcriptional activation
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00233  IGF-IGF1R-RAS-ERK signaling pathway
N00582  IGF-IGF1R-PI3K signaling pathway
N00907  GH-Jak-STAT signaling pathway
N00913  Mutation-inactivated IGF1 to RAS-ERK signaling pathway
N00914  Mutation-inactivated IGF1R to RAS-ERK signaling pathway
Disease
H00015  Malignant pleural mesothelioma
H02040  Insulin-like growth factor I deficiency
Drug target
Masoprocol: D04862
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3479 (IGF1)
   04014 Ras signaling pathway
    3479 (IGF1)
   04015 Rap1 signaling pathway
    3479 (IGF1)
   04066 HIF-1 signaling pathway
    3479 (IGF1)
   04068 FoxO signaling pathway
    3479 (IGF1)
   04151 PI3K-Akt signaling pathway
    3479 (IGF1)
   04152 AMPK signaling pathway
    3479 (IGF1)
   04150 mTOR signaling pathway
    3479 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    3479 (IGF1)
   04115 p53 signaling pathway
    3479 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3479 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    3479 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    3479 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    3479 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    3479 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3479 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    3479 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3479 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    3479 (IGF1)
   04213 Longevity regulating pathway - multiple species
    3479 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3479 (IGF1)
   05202 Transcriptional misregulation in cancer
    3479 (IGF1)
   05205 Proteoglycans in cancer
    3479 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    3479 (IGF1)
   05218 Melanoma
    3479 (IGF1)
   05215 Prostate cancer
    3479 (IGF1)
   05224 Breast cancer
    3479 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    3479 (IGF1)
   05414 Dilated cardiomyopathy
    3479 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3479 (IGF1)
   01522 Endocrine resistance
    3479 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3479 (IGF1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   3479 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 3479
NCBI-ProteinID: NP_001104755
OMIM: 147440
HGNC: 5464
Ensembl: ENSG00000017427
Pharos: P05019(Tbio)
CPD: C16131
UniProt: P05019
Structure
LinkDB
Position
12:complement(102395874..102481839)
AA seq 195 aa
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRR
EIGSRNAECRGKKGK
NT seq 588 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcgctgtgcctgctc
accttcaccagctctgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctaaggaggctggagatgtattgcgcacccctcaagcctgccaagtcagctcgctct
gtccgtgcccagcgccacaccgacatgcccaagacccagaagtatcagcccccatctacc
aacaagaacacgaagtctcagagaaggaaaggttggccaaagacacatccaggaggggaa
cagaaggaggggacagaagcaagtctgcagatcagaggaaagaagaaagagcagaggagg
gagattggaagtagaaatgctgaatgcagaggcaaaaaaggaaaatga

KEGG   Homo sapiens (human): 3630
Entry
3630              CDS       T01001                                 
Symbol
INS, IDDM, IDDM1, IDDM2, ILPR, IRDN, MODY10, PNDM4
Name
(RefSeq) insulin
  KO
K04526  insulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04911  Insulin secretion
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04940  Type I diabetes mellitus
hsa04950  Maturity onset diabetes of the young
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05010  Alzheimer disease
hsa05215  Prostate cancer
hsa05415  Diabetic cardiomyopathy
Disease
H00408  Type 1 diabetes mellitus
H00410  Maturity onset diabetes of the young (MODY)
H00512  Permanent neonatal diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3630 (INS)
   04014 Ras signaling pathway
    3630 (INS)
   04015 Rap1 signaling pathway
    3630 (INS)
   04066 HIF-1 signaling pathway
    3630 (INS)
   04068 FoxO signaling pathway
    3630 (INS)
   04072 Phospholipase D signaling pathway
    3630 (INS)
   04022 cGMP-PKG signaling pathway
    3630 (INS)
   04151 PI3K-Akt signaling pathway
    3630 (INS)
   04152 AMPK signaling pathway
    3630 (INS)
   04150 mTOR signaling pathway
    3630 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    3630 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    3630 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3630 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3630 (INS)
   04910 Insulin signaling pathway
    3630 (INS)
   04923 Regulation of lipolysis in adipocytes
    3630 (INS)
   04913 Ovarian steroidogenesis
    3630 (INS)
   04914 Progesterone-mediated oocyte maturation
    3630 (INS)
   04917 Prolactin signaling pathway
    3630 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3630 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    3630 (INS)
   04213 Longevity regulating pathway - multiple species
    3630 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    3630 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3630 (INS)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    3630 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    3630 (INS)
   04940 Type I diabetes mellitus
    3630 (INS)
   04950 Maturity onset diabetes of the young
    3630 (INS)
   04932 Non-alcoholic fatty liver disease
    3630 (INS)
   04931 Insulin resistance
    3630 (INS)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 3630
NCBI-ProteinID: NP_000198
OMIM: 176730
HGNC: 6081
Ensembl: ENSG00000254647
Pharos: P01308(Tbio)
CPD: C00723 C16120
UniProt: P01308 I3WAC9
Structure
LinkDB
Position
11:complement(2159779..2161209)
AA seq 110 aa
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac
ccagccgcagcctttgtgaaccaacacctgtgcggctcacacctggtggaagctctctac
ctagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggac
ctgcaggtggggcaggtggagctgggcgggggccctggtgcaggcagcctgcagcccttg
gccctggaggggtccctgcagaagcgtggcattgtggaacaatgctgtaccagcatctgc
tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system