KEGG   Homo sapiens (human): 3559
Entry
3559              CDS       T01001                                 
Symbol
IL2RA, CD25, IDDM10, IL2R, IMD41, TCGFR, p55
Name
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01554  IL2 family to Jak-STAT signaling pathway
Disease
H00408  Type 1 diabetes mellitus
H02526  Disorders of adaptive immunity
Drug target
Aldesleukin: D00748<US>
Antithymocyte immunoglobulin (rabbit): D09190<JP/US>
Basiliximab: D03058<JP/US>
Camidanlumab: D11324
Camidanlumab tesirine: D11325
Celmoleukin: D02743
Daclizumab: D03639
Denileukin diftitox: D03682<JP>
Melredableukin alfa: D12386
Nemvaleukin alfa: D12371
Rezpegaldesleukin: D12328
Teceleukin: D02749<JP>
Vopikitug: D12928
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3559 (IL2RA)
   04151 PI3K-Akt signaling pathway
    3559 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3559 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3559 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3559 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3559 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    3559 (IL2RA)
   04659 Th17 cell differentiation
    3559 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3559 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3559 (IL2RA)
   05162 Measles
    3559 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3559 (IL2RA)
   04090 CD molecules [BR:hsa04090]
    3559 (IL2RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3559 (IL2RA)
CD molecules [BR:hsa04090]
 Proteins
  3559 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 3559
NCBI-ProteinID: NP_000408
OMIM: 147730
HGNC: 6008
Ensembl: ENSG00000134460
UniProt: P01589
Structure
LinkDB
Position
10:complement(6010689..6062367)
AA seq 272 aa
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
NT seq 819 nt   +upstreamnt  +downstreamnt
atggattcatacctgctgatgtggggactgctcacgttcatcatggtgcctggctgccag
gcagagctctgtgacgatgacccgccagagatcccacacgccacattcaaagccatggcc
tacaaggaaggaaccatgttgaactgtgaatgcaagagaggtttccgcagaataaaaagc
gggtcactctatatgctctgtacaggaaactctagccactcgtcctgggacaaccaatgt
caatgcacaagctctgccactcggaacacaacgaaacaagtgacacctcaacctgaagaa
cagaaagaaaggaaaaccacagaaatgcaaagtccaatgcagccagtggaccaagcgagc
cttccaggtcactgcagggaacctccaccatgggaaaatgaagccacagagagaatttat
catttcgtggtggggcagatggtttattatcagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcgtctgcaaaatgacccacgggaagacaaggtggacccagccc
cagctcatatgcacaggtgaaatggagaccagtcagtttccaggtgaagagaagcctcag
gcaagccccgaaggccgtcctgagagtgagacttcctgcctcgtcacaacaacagatttt
caaatacagacagaaatggctgcaaccatggagacgtccatatttacaacagagtaccag
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctcctgagtgggctcacc
tggcagcggagacagaggaagagtagaagaacaatctag

KEGG   Homo sapiens (human): 3560
Entry
3560              CDS       T01001                                 
Symbol
IL2RB, CD122, IL15RB, IMD63, P70-75
Name
(RefSeq) interleukin 2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling (cancer)
nt06240  Transcription (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00137  EWSR1-WT1 fusion to transcriptional activation
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
N01554  IL2 family to Jak-STAT signaling pathway
Disease
H02525  Disorders of innate immunity
Drug target
Aldesleukin: D00748<US>
Bempegaldesleukin: D11669
Celmoleukin: D02743
Rezpegaldesleukin: D12328
Teceleukin: D02749<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3560 (IL2RB)
   04151 PI3K-Akt signaling pathway
    3560 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3560 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3560 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3560 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3560 (IL2RB)
   04659 Th17 cell differentiation
    3560 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3560 (IL2RB)
   05202 Transcriptional misregulation in cancer
    3560 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3560 (IL2RB)
   05162 Measles
    3560 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3560 (IL2RB)
   04090 CD molecules [BR:hsa04090]
    3560 (IL2RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3560 (IL2RB)
CD molecules [BR:hsa04090]
 Proteins
  3560 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N IL6Ra-bind
Other DBs
NCBI-GeneID: 3560
NCBI-ProteinID: NP_000869
OMIM: 146710
HGNC: 6009
Ensembl: ENSG00000100385
UniProt: P14784
Structure
LinkDB
Position
22:complement(37125838..37175118)
AA seq 551 aa
MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA
IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE
APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT
NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT
FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP
DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ
ELQGQDPTHLV
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggcggcccctgctctgtcctggcgtctgcccctcctcatcctcctcctgcccctggct
acctcttgggcatctgcagcggtgaatggcacttcccagttcacatgcttctacaactcg
agagccaacatctcctgtgtctggagccaagatggggctctgcaggacacttcctgccaa
gtccatgcctggccggacagacggcggtggaaccaaacctgtgagctgctccccgtgagt
caagcatcctgggcctgcaacctgatcctcggagccccagattctcagaaactgaccaca
gttgacatcgtcaccctgagggtgctgtgccgtgagggggtgcgatggagggtgatggcc
atccaggacttcaagccctttgagaaccttcgcctgatggcccccatctccctccaagtt
gtccacgtggagacccacagatgcaacataagctgggaaatctcccaagcctcccactac
tttgaaagacacctggagttcgaggcccggacgctgtccccaggccacacctgggaggag
gcccccctgctgactctcaagcagaagcaggaatggatctgcctggagacgctcacccca
gacacccagtatgagtttcaggtgcgggtcaagcctctgcaaggcgagttcacgacctgg
agcccctggagccagcccctggccttcaggacaaagcctgcagcccttgggaaggacacc
attccgtggctcggccacctcctcgtgggcctcagcggggcttttggcttcatcatctta
gtgtacttgctgatcaactgcaggaacaccgggccatggctgaagaaggtcctgaagtgt
aacaccccagacccctcgaagttcttttcccagctgagctcagagcatggaggagacgtc
cagaagtggctctcttcgcccttcccctcatcgtccttcagccctggcggcctggcacct
gagatctcgccactagaagtgctggagagggacaaggtgacgcagctgctcctgcagcag
gacaaggtgcctgagcccgcatccttaagcagcaaccactcgctgaccagctgcttcacc
aaccagggttacttcttcttccacctcccggatgccttggagatagaggcctgccaggtg
tactttacttacgacccctactcagaggaagaccctgatgagggtgtggccggggcaccc
acagggtcttccccccaacccctgcagcctctgtcaggggaggacgacgcctactgcacc
ttcccctccagggatgacctgctgctcttctcccccagtctcctcggtggccccagcccc
ccaagcactgcccctgggggcagtggggccggtgaagagaggatgcccccttctttgcaa
gaaagagtccccagagactgggacccccagcccctggggcctcccaccccaggagtccca
gacctggtggattttcagccaccccctgagctggtgctgcgagaggctggggaggaggtc
cctgacgctggccccagggagggagtcagtttcccctggtccaggcctcctgggcagggg
gagttcagggcccttaatgctcgcctgcccctgaacactgatgcctacttgtccctccaa
gaactccagggtcaggacccaactcacttggtgtag

KEGG   Homo sapiens (human): 3561
Entry
3561              CDS       T01001                                 
Symbol
IL2RG, CD132, CIDX, IL-2RG, IMD4, P64, SCIDX, SCIDX1
Name
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease
hsa05340  Primary immunodeficiency
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
N01554  IL2 family to Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiency
H00093  Combined immunodeficiency
Drug target
Aldesleukin: D00748<US>
Celmoleukin: D02743
Rezpegaldesleukin: D12328
Teceleukin: D02749<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3561 (IL2RG)
   04151 PI3K-Akt signaling pathway
    3561 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3561 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3561 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3561 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3561 (IL2RG)
   04659 Th17 cell differentiation
    3561 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3561 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3561 (IL2RG)
   05162 Measles
    3561 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    3561 (IL2RG)
   05340 Primary immunodeficiency
    3561 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3561 (IL2RG)
   04090 CD molecules [BR:hsa04090]
    3561 (IL2RG)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3561 (IL2RG)
CD molecules [BR:hsa04090]
 Proteins
  3561 (IL2RG)
SSDB
Motif
Pfam: TSLPR_D1 CRLF2_D1 CRLF2-like_D2 IL6Ra-bind EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 3561
NCBI-ProteinID: NP_000197
OMIM: 308380
HGNC: 6010
Ensembl: ENSG00000147168
UniProt: P31785
Structure
LinkDB
Position
X:complement(71107404..71111577)
AA seq 369 aa
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcacatccctcttattcctgcagctgcccctgctggga
gtggggctgaacacgacaattctgacgcccaatgggaatgaagacaccacagctgatttc
ttcctgaccactatgcccactgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaactcggataatgataaagtccag
aagtgcagccactatctattctctgaagaaatcacttctggctgtcagttgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccagagaaccta
acacttcacaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccttgcctagtgtggatgggcagaaacgctacacg
tttcgtgttcggagccgctttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatacttcaaaagagaatcctttcctgtttgcattg
gaagccgtggttatctctgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gcccttggggaggggcctggggcctccccatgcaaccagcatagcccctactgggccccc
ccatgttacaccctaaagcctgaaacctga

KEGG   Homo sapiens (human): 3566
Entry
3566              CDS       T01001                                 
Symbol
IL4R, CD124, IL-4RA, IL4RA
Name
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01554  IL2 family to Jak-STAT signaling pathway
N01556  IL6 family to Jak-STAT signaling pathway
Disease
H00079  Asthma
H01563  HIV infection
Drug target
Dupilumab: D10354<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3566 (IL4R)
   04151 PI3K-Akt signaling pathway
    3566 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3566 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3566 (IL4R)
   04658 Th1 and Th2 cell differentiation
    3566 (IL4R)
   04659 Th17 cell differentiation
    3566 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3566 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    3566 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3566 (IL4R)
   04090 CD molecules [BR:hsa04090]
    3566 (IL4R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3566 (IL4R)
CD molecules [BR:hsa04090]
 Proteins
  3566 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3 CRLF2-like_D2
Other DBs
NCBI-GeneID: 3566
NCBI-ProteinID: NP_000409
OMIM: 147781
HGNC: 6015
Ensembl: ENSG00000077238
UniProt: P24394
Structure
LinkDB
Position
16:27313756..27364778
AA seq 825 aa
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL
EPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS
CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCP
HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG
GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD
NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPT
TVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGE
AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE
PPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL
CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASL
APSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtg
gcaagctctgggaacatgaaggtcttgcaggagcccacctgcgtctccgactacatgagc
atctctacttgcgagtggaagatgaatggtcccaccaattgcagcaccgagctccgcctg
ttgtaccagctggtttttctgctctccgaagcccacacgtgtatccctgagaacaacgga
ggcgcggggtgcgtgtgccacctgctcatggatgacgtggtcagtgcggataactataca
ctggacctgtgggctgggcagcagctgctgtggaagggctccttcaagcccagcgagcat
gtgaaacccagggccccaggaaacctgacagttcacaccaatgtctccgacactctgctg
ctgacctggagcaacccgtatccccctgacaattacctgtataatcatctcacctatgca
gtcaacatttggagtgaaaacgacccggcagatttcagaatctataacgtgacctaccta
gaaccctccctccgcatcgcagccagcaccctgaagtctgggatttcctacagggcacgg
gtgagggcctgggctcagtgctataacaccacctggagtgagtggagccccagcaccaag
tggcacaactcctacagggagcccttcgagcagcacctcctgctgggcgtcagcgtttcc
tgcattgtcatcctggccgtctgcctgttgtgctatgtcagcatcaccaagattaagaaa
gaatggtgggatcagattcccaacccagcccgcagccgcctcgtggctataataatccag
gatgctcaggggtcacagtgggagaagcggtcccgaggccaggaaccagccaagtgccca
cactggaagaattgtcttaccaagctcttgccctgttttctggagcacaacatgaaaagg
gatgaagatcctcacaaggctgccaaagagatgcctttccagggctctggaaaatcagca
tggtgcccagtggagatcagcaagacagtcctctggccagagagcatcagcgtggtgcga
tgtgtggagttgtttgaggccccggtggagtgtgaggaggaggaggaggtagaggaagaa
aaagggagcttctgtgcatcgcctgagagcagcagggatgacttccaggagggaagggag
ggcattgtggcccggctaacagagagcctgttcctggacctgctcggagaggagaatggg
ggcttttgccagcaggacatgggggagtcatgccttcttccaccttcgggaagtacgagt
gctcacatgccctgggatgagttcccaagtgcagggcccaaggaggcacctccctggggc
aaggagcagcctctccacctggagccaagtcctcctgccagcccgacccagagtccagac
aacctgacttgcacagagacgcccctcgtcatcgcaggcaaccctgcttaccgcagcttc
agcaactccctgagccagtcaccgtgtcccagagagctgggtccagacccactgctggcc
agacacctggaggaagtagaacccgagatgccctgtgtcccccagctctctgagccaacc
actgtgccccaacctgagccagaaacctgggagcagatcctccgccgaaatgtcctccag
catggggcagctgcagcccccgtctcggcccccaccagtggctatcaggagtttgtacat
gcggtggagcagggtggcacccaggccagtgcggtggtgggcttgggtcccccaggagag
gctggttacaaggccttctcaagcctgcttgccagcagtgctgtgtccccagagaaatgt
gggtttggggctagcagtggggaagaggggtataagcctttccaagacctcattcctggc
tgccctggggaccctgccccagtccctgtccccttgttcacctttggactggacagggag
ccacctcgcagtccgcagagctcacatctcccaagcagctccccagagcacctgggtctg
gagccgggggaaaaggtagaggacatgccaaagcccccacttccccaggagcaggccaca
gacccccttgtggacagcctgggcagtggcattgtctactcagcccttacctgccacctg
tgcggccacctgaaacagtgtcatggccaggaggatggtggccagacccctgtcatggcc
agtccttgctgtggctgctgctgtggagacaggtcctcgccccctacaacccccctgagg
gccccagacccctctccaggtggggttccactggaggccagtctgtgtccggcctccctg
gcaccctcgggcatctcagagaagagtaaatcctcatcatccttccatcctgcccctggc
aatgctcagagctcaagccagacccccaaaatcgtgaactttgtctccgtgggacccaca
tacatgagggtctcttag

KEGG   Homo sapiens (human): 3575
Entry
3575              CDS       T01001                                 
Symbol
IL7R, CD127, CDW127, IL-7R-alpha, IL-7Ralpha, IL7RA, IL7Ralpha, ILRA, IMD104, lnc-IL7R, sIL-7R
Name
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
hsa05340  Primary immunodeficiency
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01554  IL2 family to Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiency
Drug target
Bempikibart: D12739
Lusvertikimab: D12479
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3575 (IL7R)
   04068 FoxO signaling pathway
    3575 (IL7R)
   04151 PI3K-Akt signaling pathway
    3575 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3575 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3575 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3575 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    3575 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3575 (IL7R)
   04090 CD molecules [BR:hsa04090]
    3575 (IL7R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3575 (IL7R)
CD molecules [BR:hsa04090]
 Proteins
  3575 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 TssR_M Sp38_C
Other DBs
NCBI-GeneID: 3575
NCBI-ProteinID: NP_002176
OMIM: 146661
HGNC: 6024
Ensembl: ENSG00000168685
UniProt: P16871
Structure
LinkDB
Position
5:35856891..35879603
AA seq 459 aa
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTH
VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatggttttttctttacttcaagtcgtttctgga
gaaagtggctatgctcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcgcagcactcactgacctgtgcttttgag
gacccagatgtcaacatcaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgaatttcaggaaactacaagagatatatttcatcgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggagaaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctgagtgtcgtctatcgg
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtatgta
aaagttttaatgcacgatgtagcttaccgccaggaaaaggatgaaaacaaatggacgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaagctccaaccggcagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagtgaatgg
agtccaagttattacttcagaactccagagatcaataatagctcaggggagatggatcct
atcttactaaccatcagcattttgagttttttctctgtcgctctgttggtcatcttggcc
tgtgtgttatggaaaaaaaggattaagcctatcgtatggcccagtctccccgatcataag
aagactctggaacatctttgtaagaaaccaagaaaaaatttaaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggttttctgcaagatacgtttcctcagcaactagaagaatctgagaagcagaggctt
ggaggggatgtgcagagccccaactgcccatctgaggatgtagtcatcactccagaaagc
tttggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgacgcccct
attctctcctcttccaggtccctagactgcagggagagtggcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcacgctgccccctccattttct
ctccaatctggaatcctgacattgaacccagttgctcagggtcagcccattcttacttcc
ctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

KEGG   Homo sapiens (human): 3581
Entry
3581              CDS       T01001                                 
Symbol
IL9R, CD129, IL-9R
Name
(RefSeq) interleukin 9 receptor
  KO
K05073  interleukin 9 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
Network
nt06518  JAK-STAT signaling
  Element
N01554  IL2 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3581 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3581 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3581 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3581 (IL9R)
   04090 CD molecules [BR:hsa04090]
    3581 (IL9R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3581 (IL9R)
CD molecules [BR:hsa04090]
 Proteins
  3581 (IL9R)
SSDB
Other DBs
NCBI-GeneID: 3581
NCBI-ProteinID: NP_002177
OMIM: 300007
HGNC: 6030
Ensembl: ENSG00000124334 ENSG00000292373
UniProt: Q01113
Structure
LinkDB
Position
X:155997696..156013020, Y:57184072..57197869
AA seq 521 aa
MGLGRCIWEGWTLESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNN
ILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTI
TFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLS
YELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEER
YTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIFLLLTGPTYLLFKLSPRVKRI
FYQNVPSPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEPCVQEATALLT
CGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQEDWAPTSLTR
PAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQG
LETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgggactgggcagatgcatctgggaaggctggaccttggagagtgaggccctgaggcga
gacatgggcacctggctcctggcctgcatctgcatctgcacctgtgtctgcttgggagtc
tctgtcacaggggaaggacaagggccaaggtctagaaccttcacctgcctcaccaacaac
attctcaggatcgattgccactggtctgccccagagctgggacagggctccagcccctgg
ctcctcttcaccagcaaccaggctcctggcggcacacataagtgcatcttgcggggcagt
gagtgcaccgtcgtgctgccacctgaggcagtgctcgtgccatctgacaatttcaccatc
actttccaccactgcatgtctgggagggagcaggtcagcctggtggacccggagtacctg
ccccggagacacgttaagctggacccgccctctgacttgcagagcaacatcagttctggc
cactgcatcctgacctggagcatcagtcctgccttggagccaatgaccacacttctcagc
tatgagctggccttcaagaagcaggaagaggcctgggagcaggcccagcacagggatcac
attgtcggggtgacctggcttatacttgaagcctttgagctggaccctggctttatccat
gaggccaggctgcgtgtccagatggccacactggaggatgatgtggtagaggaggagcgt
tatacaggccagtggagtgagtggagccagcctgtgtgcttccaggctccccagagacaa
ggccctctgatcccaccctgggggtggccaggcaacacccttgttgctgtgtccatcttt
ctcctgctgactggcccgacctacctcctgttcaagctgtcgcccagggtgaagagaatc
ttctaccagaacgtgccctctccagcgatgttcttccagcccctctacagtgtacacaat
gggaacttccagacttggatgggggcccacggggccggtgtgctgttgagccaggactgt
gctggcaccccacagggagccttggagccctgcgtccaggaggccactgcactgctcact
tgtggcccagcgcgtccttggaaatctgtggccctggaggaggaacaggagggccctggg
accaggctcccggggaacctgagctcagaggatgtgctgccagcagggtgtacggagtgg
agggtacagacgcttgcctatctgccacaggaggactgggcccccacgtccctgactagg
ccggctcccccagactcagagggcagcaggagcagcagcagcagcagcagcagcaacaac
aacaactactgtgccttgggctgctatgggggatggcacctctcagccctcccaggaaac
acacagagctctgggcccatcccagccctggcctgtggcctttcttgtgaccatcagggc
ctggagacccagcaaggagttgcctgggtgctggctggtcactgccagaggcctgggctg
catgaggacctccagggcatgttgctcccttctgtcctcagcaaggctcggtcctggaca
ttctag

KEGG   Homo sapiens (human): 3601
Entry
3601              CDS       T01001                                 
Symbol
IL15RA, CD215
Name
(RefSeq) interleukin 15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01554  IL2 family to Jak-STAT signaling pathway
Drug target
Inbakicept: D11747
Nanrilkefusp alfa: D12623
Nogapendekin alfa: D11821
Nogapendekin alfa inbakicept: D12888<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3601 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3601 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    3601 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3601 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3601 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3601 (IL15RA)
   04090 CD molecules [BR:hsa04090]
    3601 (IL15RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3601 (IL15RA)
CD molecules [BR:hsa04090]
 Proteins
  3601 (IL15RA)
SSDB
Motif
Pfam: RamS Sushi TMEM52
Other DBs
NCBI-GeneID: 3601
NCBI-ProteinID: NP_002180
OMIM: 601070
HGNC: 5978
Ensembl: ENSG00000134470
UniProt: Q13261
Structure
LinkDB
Position
10:complement(5948900..5978741)
AA seq 267 aa
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE
SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA
KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE
MEAMEALPVTWGTSSRDEDLENCSHHL
NT seq 804 nt   +upstreamnt  +downstreamnt
atggccccgcggcgggcgcgcggctgccggaccctcggtctcccggcgctgctactgctg
ctgctgctccggccgccggcgacgcggggcatcacgtgccctccccccatgtccgtggaa
cacgcagacatctgggtcaagagctacagcttgtactccagggagcggtacatttgtaac
tctggtttcaagcgtaaagccggcacgtccagcctgacggagtgcgtgttgaacaaggcc
acgaatgtcgcccactggacaacccccagtctcaaatgcattagagaccctgccctggtt
caccaaaggccagcgccaccctccacagtaacgacggcaggggtgaccccacagccagag
agcctctccccttctggaaaagagcccgcagcttcatctcccagctcaaacaacacagcg
gccacaacagcagctattgtcccgggctcccagctgatgccttcaaaatcaccttccaca
ggaaccacagagataagcagtcatgagtcctcccacggcaccccctctcagacaacagcc
aagaactgggaactcacagcatccgcctcccaccagccgccaggtgtgtatccacagggc
cacagcgacaccactgtggctatctccacgtccactgtcctgctgtgtgggctgagcgct
gtgtctctcctggcatgctacctcaagtcaaggcaaactcccccgctggccagcgttgaa
atggaagccatggaggctctgccggtgacttgggggaccagcagcagagatgaagacttg
gaaaactgctctcaccacctatga

KEGG   Homo sapiens (human): 50615
Entry
50615             CDS       T01001                                 
Symbol
IL21R, CD360, IMD56, NILR
Name
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05321  Inflammatory bowel disease
Network
nt06518  JAK-STAT signaling
  Element
N01554  IL2 family to Jak-STAT signaling pathway
Disease
H02526  Disorders of adaptive immunity
Drug target
Denenicokin: D09332
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    50615 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50615 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    50615 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    50615 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    50615 (IL21R)
   04090 CD molecules [BR:hsa04090]
    50615 (IL21R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   50615 (IL21R)
CD molecules [BR:hsa04090]
 Proteins
  50615 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N Phage_holin_T CRLF2-like_D2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 50615
NCBI-ProteinID: NP_068570
OMIM: 605383
HGNC: 6006
Ensembl: ENSG00000103522
UniProt: Q9HBE5
Structure
LinkDB
Position
16:27402174..27452042
AA seq 538 aa
MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSS
LELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGG
SAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgccgcgtggctgggccgcccccttgctcctgctgctgctccagggaggctggggctgc
cccgacctcgtctgctacaccgattacctccagacggtcatctgcatcctggaaatgtgg
aacctccaccccagcacgctcacccttacctggcaagaccagtatgaagagctgaaggac
gaggccacctcctgcagcctccacaggtcggcccacaatgccacgcatgccacctacacc
tgccacatggatgtattccacttcatggccgacgacattttcagtgtcaacatcacagac
cagtctggcaactactcccaggagtgtggcagctttctcctggctgagagcatcaagccg
gctccccctttcaacgtgactgtgaccttctcaggacagtataatatctcctggcgctca
gattacgaagaccctgccttctacatgctgaagggcaagcttcagtatgagctgcagtac
aggaaccggggagacccctgggctgtgagtccgaggagaaagctgatctcagtggactca
agaagtgtctccctcctccccctggagttccgcaaagactcgagctatgagctgcaggtg
cgggcagggcccatgcctggctcctcctaccaggggacctggagtgaatggagtgacccg
gtcatctttcagacccagtcagaggagttaaaggaaggctggaaccctcacctgctgctt
ctcctcctgcttgtcatagtcttcattcctgccttctggagcctgaagacccatccattg
tggaggctatggaagaagatatgggccgtccccagccctgagcggttcttcatgcccctg
tacaagggctgcagcggagacttcaagaaatgggtgggtgcacccttcactggctccagc
ctggagctgggaccctggagcccagaggtgccctccaccctggaggtgtacagctgccac
ccaccacggagcccggccaagaggctgcagctcacggagctacaagaaccagcagagctg
gtggagtctgacggtgtgcccaagcccagcttctggccgacagcccagaactcggggggc
tcagcttacagtgaggagagggatcggccatacggcctggtgtccattgacacagtgact
gtgctagatgcagaggggccatgcacctggccctgcagctgtgaggatgacggctaccca
gccctggacctggatgctggcctggagcccagcccaggcctagaggacccactcttggat
gcagggaccacagtcctgtcctgtggctgtgtctcagctggcagccctgggctaggaggg
cccctgggaagcctcctggacagactaaagccaccccttgcagatggggaggactgggct
gggggactgccctggggtggccggtcacctggaggggtctcagagagtgaggcgggctca
cccctggccggcctggatatggacacgtttgacagtggctttgtgggctctgactgcagc
agccctgtggagtgtgacttcaccagccccggggacgaaggacccccccggagctacctc
cgccagtgggtggtcattcctccgccactttcgagccctggaccccaggccagctaa

KEGG   Homo sapiens (human): 64109
Entry
64109             CDS       T01001                                 
Symbol
CRLF2, CRL2, CRLF2Y, TSLPR
Name
(RefSeq) cytokine receptor like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01554  IL2 family to Jak-STAT signaling pathway
Disease
H00001  B-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    64109 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    64109 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    64109 (CRLF2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   64109 (CRLF2)
SSDB
Motif
Pfam: CRLF2-like_D2 TSLPR_D1 CRLF2_D1 fn3 Tissue_fac Pur_ac_phosph_N C1-set IL6Ra-bind Interfer-bind
Other DBs
NCBI-GeneID: 64109
NCBI-ProteinID: NP_071431
OMIM: 300357 400023
HGNC: 14281
Ensembl: ENSG00000205755 ENSG00000292363
UniProt: Q9HC73 D0E2W4
Structure
LinkDB
Position
X:complement(1190490..1212649), Y:complement(1190490..1212649)
AA seq 371 aa
MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHY
RFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPS
SPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKC
YSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKFILISSLAI
LLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQGNFQEWITDTQNVAHLHKMA
GAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQGGDVVTIGGFT
FVMNDRSYVAL
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggggcggctggttctgctgtggggagctgccgtctttctgctgggaggctggatggct
ttggggcaaggaggagcagcagaaggagtacagattcagatcatctacttcaatttagaa
accgtgcaggtgacatggaatgccagcaaatactccaggaccaacctgactttccactac
agattcaacggtgatgaggcctatgaccagtgcaccaactaccttctccaggaaggtcac
acttcggggtgcctcctagacgcagagcagcgagacgacattctctatttctccatcagg
aatgggacgcaccccgttttcaccgcaagtcgctggatggtttattacctgaaacccagt
tccccgaagcacgtgagattttcgtggcatcaggatgcagtgacggtgacgtgttctgac
ctgtcctacggggatctcctctatgaggttcagtaccggagccccttcgacaccgagtgg
cagtccaaacaggaaaatacctgcaacgtcaccatagaaggcttggatgccgagaagtgt
tactctttctgggtcagggtgaaggctatggaggatgtatatgggccagacacataccca
agcgactggtcagaggtgacatgctggcagagaggcgagattcgggatgcctgtgcagag
acaccaacgcctcccaaaccaaagctgtccaaatttattttaatttccagcctggccatc
cttctgatggtgtctctcctccttctgtctttatggaaattatggagagtgaagaagttt
ctcattcccagcgtgccagacccgaaatccatcttccccgggctctttgagatacaccaa
gggaacttccaggagtggatcacagacacccagaacgtggcccacctccacaagatggca
ggtgcagagcaagaaagtggccccgaggagcccctggtagtccagttggccaagactgaa
gccgagtctcccaggatgctggacccacagaccgaggagaaagaggcctctgggggatcc
ctccagcttccccaccagcccctccaaggcggtgatgtggtcacaatcgggggcttcacc
tttgtgatgaatgaccgctcctacgtggcgttgtga

DBGET integrated database retrieval system