KEGG   Homo sapiens (human): 3612
Entry
3612              CDS       T01001                                 
Symbol
IMPA1, IMP, IMPA, MRT59
Name
(RefSeq) inositol monophosphatase 1
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Disease
H00768  Autosomal recessive intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3612 (IMPA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    3612 (IMPA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     3612 (IMPA1)
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-GeneID: 3612
NCBI-ProteinID: NP_005527
OMIM: 602064
HGNC: 6050
Ensembl: ENSG00000133731
Pharos: P29218(Tclin)
UniProt: P29218 A0A024R830
Structure
LinkDB
Position
8:complement(81656914..81686325)
AA seq 277 aa
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKE
KYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFG
VVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNME
KLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTG
GPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
NT seq 834 nt   +upstreamnt  +downstreamnt
atggctgatccttggcaggaatgcatggattatgcagtaactctagcaagacaagctgga
gaggtagtttgtgaagctataaaaaatgaaatgaatgttatgctgaaaagttctccagtt
gatttggtaactgctacggaccaaaaagttgaaaaaatgcttatctcttccataaaggaa
aagtatccatctcacagtttcattggtgaagaatctgtggcagctggggaaaaaagtatc
ttaaccgacaaccccacatggatcattgaccctattgatggaacaactaactttgtacat
agatttccttttgtagctgtttcaattggctttgctgtaaataaaaagatagaatttgga
gttgtgtacagttgtgtggaaggcaagatgtacactgccagaaaaggaaaaggtgccttt
tgtaatggtcaaaaactacaagtttcacaacaagaagatattaccaaatctctcttggtg
actgagttgggctcttccagaacaccagagactgtgagaatggttctttctaatatggaa
aagcttttttgcattcctgttcatgggatccggagtgttggaacagcagctgttaatatg
tgccttgtggcaactggcggagcagatgcatattatgaaatgggaattcactgctgggat
gttgcaggagctggcattattgttactgaagctggtggcgtgctaatggatgttacaggt
ggaccatttgatttgatgtcacgaagagtaattgctgcaaataatagaatattagcagaa
aggatagctaaagaaattcaggttatacctttgcaacgagacgacgaagattaa

KEGG   Homo sapiens (human): 3613
Entry
3613              CDS       T01001                                 
Symbol
IMPA2
Name
(RefSeq) inositol monophosphatase 2
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3613 (IMPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    3613 (IMPA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     3613 (IMPA2)
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-GeneID: 3613
NCBI-ProteinID: NP_055029
OMIM: 605922
HGNC: 6051
Ensembl: ENSG00000141401
Pharos: O14732(Tbio)
UniProt: O14732
Structure
LinkDB
Position
18:11981507..12030877
AA seq 288 aa
MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL
VEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSI
GFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDP
ATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIR
EAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaagccgagcggcgaggaccaggcggcgctggcggccggcccctgggaggagtgcttc
caggcggccgtgcagctggcgctgcgggcaggacagatcatcagaaaagcccttactgag
gaaaaacgtgtctcaacaaaaacatcagctgcagatcttgtgacagaaacagatcacctt
gtggaagatttaattatttctgagttgcgagagaggtttccttcacacaggttcattgca
gaagaggccgcggcttctggggccaagtgtgtgctcacccacagcccgacgtggatcatc
gaccccatcgacggcacctgcaattttgtgcacagattcccgactgtggcggttagcatt
ggatttgctgttcgacaagagcttgaattcggagtgatttaccactgcacagaggagcgg
ctgtacacgggccggcggggtcggggcgccttctgcaatggccagcggctccgggtctcc
ggggagacagatctctcaaaggccttggttctgacagaaattggccccaaacgtgaccct
gcgaccctgaagctgttcctgagtaacatggagcggctgctgcatgccaaggcgcatggg
gtccgagtgattggaagctccacattggcactctgccacctggcctcaggggccgcggat
gcctattaccagtttggcctgcactgctgggatctggcggctgccacagtcatcatcaga
gaagcaggcggcatcgtgatagacacttcgggtggacccctcgacctcatggcttgcaga
gtggttgcggccagcacccgggagatggcgatgctcatagctcaggccttacagacgatt
aactatgggcgggatgatgagaagtga

DBGET integrated database retrieval system