KEGG   Homo sapiens (human): 3631
Entry
3631              CDS       T01001                                 

Symbol
INPP4A, INPP4, TVAS1
Name
(RefSeq) inositol polyphosphate-4-phosphatase type I A
  KO
K01109  inositol polyphosphate-4-phosphatase [EC:3.1.3.66]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3631 (INPP4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    3631 (INPP4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.66  phosphatidylinositol-3,4-bisphosphate 4-phosphatase
     3631 (INPP4A)
SSDB
Motif
Pfam: C2 NHR2
Other DBs
NCBI-GeneID: 3631
NCBI-ProteinID: NP_001127696
OMIM: 600916
HGNC: 6074
Ensembl: ENSG00000040933
Vega: OTTHUMG00000153106
Pharos: Q96PE3(Tbio)
UniProt: Q96PE3
LinkDB
Position
2:98444538..98594392
AA seq 977 aa
MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSL
DRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVY
DVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQR
PPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDG
NHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEELGELSPCWESLRRQIVTQYQT
IILTYQENLTDLHQYRGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGGSDQNYDIVTI
GAPAAHCQGFKSGGLRKKLHKFEETKKHFEECCTSSGCQSIIYIPQDVVRAKEIIAQINT
LKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARPD
YIASKASPTSTEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLEC
IIQRVDKLLQKERLHGEGCEDVFPCAGSCTSKKGNPDSHAYWIRPEDPFCDVPSSPCPST
MPSTACHPHLTTHCSPPPEESSPGEWSEALYPLLTTLTDCVAMMSDKAKKAMVFLLMQDS
APTIATYLSLQYRRDVVFCQTLTALICGFIIKLRNCLHDDGFLRQLYTIGLLAQFESLLS
TYGEELAMLEDMSLGIMDLRNVTFKVTQATSSASADMLPVITGNRDGFNVRVPLPGPLFD
ALPREIQSGMLLRVQPVLFNVGINEQQTLAERFGDTSLQEVINVESLVRLNSYFEQFKEV
LPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILWQAAEICRRLNGVRFTSCKSAKD
RTAMSVTLEQCLILQHEHGMAPQVFTQALECMRSEGCRRENTMKNVGSRKYAFNSLQLKA
FPKHYRPPEGTYGKVET
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgacagcaagagagcacagccctcgccatggtgccagggcccgtgcaatgcagcgggct
tccaccatcgacgtggcggccgacatgctgggcctctctctggcaggaaatatacaagac
ccagatgagcccattttagaatttagcttagcttgcagtgagctgcatactccatcgcta
gatcgaaagccaaatagttttgttgcggtgagtgtcaccacccctcctcaggcattctgg
acgaagcatgcacagacggagatcattgagggaaccaacaatcctatatttctaagcagt
attgccttctttcaagactctcttatcaatcagatgacacaagtcaaactctccgtgtat
gatgtcaaagatagatctcagggaacaatgtatttactgggctctggaacgttcattgtc
aaagatctgctccaggacaggcatcataggttgcatttaacactaaggtctgcagagagt
gaccgtgtaggtaacatcaccgtgattggctggcagatggaggagaagtcagaccaacgg
ccccctgtgacccggtctgtggacactgtcaatgggaggatggttcttcctgtcgatgag
agcttgacggaggcgttaggaatccgatccaaatacgcttcattgcgaaaggacactttg
ctgaaatcggtgttcggtggtgccatctgccgcatgtaccggtttccaaccactgatggt
aaccatttgcggatcctggagcagatggcagagagcgtgctctccctgcacgtgccccgg
cagttcgtgaagctcctactagaggaagatgcagccagagtgtgtgagctggaggagctg
ggagagctgtccccttgctgggagagcctccggcgccaaattgtcacccagtaccagacc
atcatcctcacataccaggagaacctgaccgacctccatcagtacagagggccctcgttt
aaagcaagcagtttgaaagcagataaaaagttagaatttgttcccacaaacttgcacata
caaaggatgagagttcaagacgatggaggatcagatcagaactacgacatcgtcaccatt
ggggcgccagcagcacactgccaaggttttaagtcaggaggtctccgcaaaaagctgcac
aaatttgaagagaccaagaaacattttgaggagtgttgtacatcatctggctgccagtcc
ataatctacataccccaggatgttgtcagagccaaggagatcatcgcccagatcaacacc
ctgaaaacccaagtgagttactacgcagagcggctgtcaagggcagccaaggacaggtct
gccactggccttgagaggacactcgccatcttggcagacaagacacggcagctggtcacg
gtctgcgactgcaagctcctggccaactccatccatgggctgaacgctgcacggcctgac
tacattgcctccaaggcctctcccacttcgactgaggaggagcaggtgatgcttagaaat
gaccaggacaccctcatggcccggtggacagggagaaacagccgatcttccctgcaggtg
gactggcacgaggaggagtgggagaaagtgtggctgaacgtggacaagagcctagagtgc
atcattcagcgtgtggacaagctgctgcagaaggagcggctgcatggcgagggctgtgag
gatgtcttcccctgtgcaggcagctgcaccagcaagaaaggtaacccggacagccacgcc
tactggatcagaccagaagaccccttctgtgatgtcccctcctcaccatgcccctccacc
atgccctccactgcatgccatcctcatctgaccacacattgcagtccccctcctgaagag
tccagcccaggtgaatggagtgaggccctttacccgctgctgaccactctcaccgactgc
gtggccatgatgagtgacaaggccaagaaggccatggtattcctgctcatgcaggacagc
gcgcccaccatagccacctacctgagcctgcagtaccgccgtgacgtggtcttctgccag
acgctgaccgccctcatctgcggcttcatcattaagctgaggaactgcctgcatgacgac
ggcttcctgcgccagctctacaccatcgggctgctggcccagttcgagagcctgctgagc
acctacggggaggagctggcaatgctggaggacatgagccttgggatcatggacttgagg
aacgtgaccttcaaagtcactcaggccacttccagcgcctccgcagacatgctgcccgtc
atcacaggaaatcgcgacgggtttaacgtgcgggtccctctgccgggcccgctgtttgac
gccttgccccgggagatccagagtggcatgctgctgcgagtgcagcccgtcctcttcaac
gtgggcatcaatgagcagcagacactggccgagaggtttggcgatacgtctttacaagaa
gtcatcaacgtggagagtttggtgcggttaaattcctactttgagcagtttaaggaagtt
ttgcctgaggattgcctgcctcggtctcgcagtcagacgtgcctgccagagctgctgcgg
tttctgggtcagaacgtgcatgcccggaagaataagaacgtcgacattctctggcaagct
gctgagatctgccgccgccttaatggggtccggttcaccagctgcaagagcgctaaggac
cgtacagccatgtcggtgacactggagcagtgcctgatcctgcaacacgagcatggcatg
gccccgcaggtcttcacccaggccctggagtgcatgcgcagtgagggttgtcgaagagaa
aatacaatgaagaatgttggaagtcgcaaatatgcatttaattccctgcagctgaaggct
ttccccaagcattacaggcctcccgaagggacttacggaaaagttgaaacgtga

KEGG   Homo sapiens (human): 8821
Entry
8821              CDS       T01001                                 

Symbol
INPP4B
Name
(RefSeq) inositol polyphosphate-4-phosphatase type II B
  KO
K01109  inositol polyphosphate-4-phosphatase [EC:3.1.3.66]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8821 (INPP4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8821 (INPP4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.66  phosphatidylinositol-3,4-bisphosphate 4-phosphatase
     8821 (INPP4B)
SSDB
Motif
Pfam: NHR2 Syntaxin-18_N MRP-S23
Other DBs
NCBI-GeneID: 8821
NCBI-ProteinID: NP_001095139
OMIM: 607494
HGNC: 6075
Ensembl: ENSG00000109452
Vega: OTTHUMG00000161341
Pharos: O15327(Tbio)
UniProt: O15327
LinkDB
Position
4:complement(142023160..142846535)
AA seq 924 aa
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLN
TLVQISVIHPVEQSLTRYSSTEIVEGTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDK
SHDTVRTSVLPEHKDPPPEVGRSFLGYASFKVGELLKSKEQLLVLSLRTSDGGKVVGTIE
VSVVKMGEIEDGEADHITTDVQGQKCALVCECTAPESVSGKDNLPFLNSVLKNPVCKLYR
FPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRNQEIKELGELSPHWDNLRKNV
LTHCDQMVNMYQDILTELSKETGSSFKSSSSKGEKTLEFVPINLHLQRMQVHSPHLKDAL
YDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGG
ILKKPPSPKSSTEESSPQDQPPVMRGQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVD
KLIERDGGSEGSGGNNDGEKEPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQ
SLTFVLLQELAYSLPQCLMLTLRRDIVFSQALAGLVCGFIIKLQTSLYDPGFLQQLHTVG
LIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAKSNDVLPVITGRREHYVVEVK
LPARMFESLPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESINQENFELLQEY
YKIFMEKMPPDYISHFQEQNDLKALLENLLQNIQSKKRKNVEIMWLAATICRKLNGIRFT
CCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNIKCRKYAF
NMLQLMAFPKYYRPPEGTYGKADT
NT seq 2775 nt   +upstreamnt  +downstreamnt
atggaaattaaagaggaaggggcatcagaagaagggcagcactttcttcctacagcccag
gccaatgatcccggggactgtcagttcacaagtatccagaagactccaaatgaaccgcag
ttggaattcatccttgcatgcaaggatctcgtggctcctgtccgtgatcgtaaactgaat
acactggtgcagatctccgtaatccaccccgtggagcagagtctgacaagatactccagc
accgaaattgtggagggaacaagggacccactgtttttgactggtgtcacattcccatct
gagtatcccatctatgaggagaccaaaataaaactaacagtctatgatgtcaaggataag
tctcatgacaccgttcgaaccagtgtcctaccagaacataaggatcccccgccagaagtt
gggcgaagtttcttgggctatgccagttttaaagtgggagagctgctgaagtcaaaggag
caattgctggtcctgagcctgagaacttcagatggtggcaaagtggttggcaccatagaa
gtcagtgtcgtgaagatgggggagattgaggatggggaagccgaccacatcaccacagat
gtacagggacaaaagtgtgccctggtatgtgaatgtacagccccggaaagtgtgagcgga
aaagataacttaccttttttgaattcagtgttaaagaacccagtatgtaaattatataga
tttcccacatctgacaataagtggatgcgaattcgagagcagatgtcagagagcattctt
tcctttcatattcctaaggaattgatttcccttcacattaaagaagatttgtgcagaaac
caggagataaaagaacttggtgagctttctccacattgggacaatctgcgaaaaaatgtc
cttactcactgtgatcaaatggtgaatatgtaccaagacattctgacagaacttagcaag
gaaacagggtcctctttcaaatcaagcagcagcaaaggagagaaaacattagaatttgtt
ccaataaatctacatctgcaaagaatgcaggtacacagccctcacttgaaagatgctctc
tacgatgtcatcactgtgggagccccagctgcccattttcagggatttaagaatggtggt
cttcggaagctactccatagatttgaaacagaaagaagaaataccggataccagtttatt
tactattcacctgaaaacacagccaaagcaaaggaagttctcagcaacatcaatcaacta
caacctcttatagcaacccatgcagacctactgcttaattctgcaagccagcattctcca
gacagcttgaagaattctttaaagatgctttcagaaaaaacagagctttttgtacatgcc
ttcaaggatcaacttgtcaggagtgctcttttagcactctacactgcaaggccaggaggc
attcttaagaagccaccctctcctaagagcagcacagaggagagcagtccccaagaccaa
cccccagtgatgagagggcaggactccataccacatcattcagactatgatgaggaagag
tgggacagggtgtgggccaatgtggggaagagcctgaactgcattattgctatggtggac
aaactgattgaaagagatggtggcagtgaaggcagtggcggcaacaatgatggagaaaag
gaaccttcattaacagatgccattccctctcacccaagagaggactggtatgaacagttg
tatcccctcatccttaccctgaaggactgcatgggagaagtggtgaaccgagccaagcag
tccctgacatttgtgctccttcaggaacttgcgtacagcttgccccagtgtctgatgctg
acgctaagaagagacatcgtcttcagccaagcacttgctggattggtttgtggttttatc
atcaaattacagacaagtctgtatgacccaggcttcctacagcagcttcacacagtgggg
ttgatagtacaatatgaaggactgctaagtacatacagcgatgaaattggaatgctagag
gacatggccgttggcatttccgatttaaagaaagttgcatttaaaataattgaagccaaa
tccaatgatgtgttgccagttataacaggaagacgagaacattacgtggtagaggtcaag
cttccagccagaatgtttgagtcactacctctacagattaaagaaggacagttgcttcat
gtgtatccagtactttttaatgttggaatcaatgaacagcaaactctggctgaaaggttt
ggagatgtctctttgcaagaaagtattaatcaggaaaacttcgaacttctacaagaatat
tacaagatatttatggaaaagatgcctcctgattatatttcacattttcaggaacaaaat
gatttaaaagcattgctagaaaatctccttcaaaatatccaatccaaaaaaagaaagaat
gtagaaattatgtggctggctgcaacgatttgccgcaaactgaatggtattcgtttcacc
tgttgtaaaagtgccaaagacaggacatcgatgtcagtgacacttgaacaatgctcaatc
ttgagagatgagcaccagttacacaaggacttctttatccgagcgctggattgcatgaga
agagaaggatgccgcatagagaatgtactgaagaatatcaaatgcagaaagtatgctttc
aacatgctacagctgatggctttccccaagtactacagacctccagaggggacttatgga
aaagctgacacctaa

DBGET integrated database retrieval system