KEGG   Homo sapiens (human): 3633
Entry
3633              CDS       T01001                                 
Symbol
INPP5B, 5PTase
Name
(RefSeq) inositol polyphosphate-5-phosphatase B
  KO
K01099  inositol polyphosphate 5-phosphatase INPP5B/F [EC:3.1.3.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3633 (INPP5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    3633 (INPP5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3633 (INPP5B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     3633 (INPP5B)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    3633 (INPP5B)
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    3633 (INPP5B)
  Rab GTPases and associated proteins
   Rab associated proteins
    3633 (INPP5B)
 Protein recycling
   Other Rab GTPase associated proteins
    3633 (INPP5B)
 Endosome - Golgi transport
   Rab associated proteins
    3633 (INPP5B)
SSDB
Motif
Pfam: INPP5B_PH RhoGAP Exo_endo_phos
Other DBs
NCBI-GeneID: 3633
NCBI-ProteinID: NP_005531
OMIM: 147264
HGNC: 6077
Ensembl: ENSG00000204084
Vega: OTTHUMG00000004436
Pharos: P32019(Tbio)
UniProt: P32019
Structure
LinkDB
Position
1:complement(37860697..37947057)
AA seq 913 aa
MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRM
AITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRM
FLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGGS
NFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQK
FGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVG
FQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAY
ISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICS
RMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKI
QVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQS
HMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQ
NVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLEL
FVNKMTATKLNSGEDKIEDILVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILD
LPLETISELTLMPVWTGDDGSQLDSPMEIPKELWMMVDYLYRNAVQQEDLFQQPGLRSEF
EHIRDCLDTGMIDNLSASNHSVAEALLLFLESLPEPVICYSTYHNCLECSGNYTASKQVI
STLPIFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFGSLLLRNPAGHQKLDMTEKKK
AQEFIHQFLCNPL
NT seq 2742 nt   +upstreamnt  +downstreamnt
atggaccagtctgtggcaatccaggagacgctggctgagggggaatactgcgtcatcgcg
gtgcaaggtgtgctgtgtgagggggacagccggcagagccgcctcctgggactcgtgcgc
taccgcctggagcacggcggccaggaacacgctctcttcctctatacgcaccggaggatg
gccattaccggggacgatgtctctctggaccagatagtgccagtctcgcgggattttacg
ctggaagaagtgtccccagatggtgaactctacatccttggctcagatgtgaccgtccag
ctggacacagcagagcttagcctcgtattccaactgccctttggttcacaaaccaggatg
ttcctccacgaagttgccagggcctgtccaggcttcgattctgcgacccgggatcctgaa
ttcctgtggctgtctcggtataggtgcgcagagctggagctggagatgccaacgccgcgc
ggttgtaactcggccctagttacctggccagggtacgcgacaattggcggaggtggttct
aactttgatggtttgagaccaaatgggaagggagtgcctatggaccaaagctccaggggt
caagataaaccagaaagcttgcaaccaagacagaataaatccaagtccgaaattactgac
atggttcgctcctccactatcacagtgtcggacaaggctcatattttatccatgcagaag
tttggactgcgagatacaattgtgaaatcacatctactacagaaagaagaggattacacc
tatatccagaacttcaggttttttgcgggaacatacaatgtaaatgggcagtcccccaaa
gaatgcctccggctgtggctgagcaatggtatccaggccccagatgtctattgtgtaggg
ttccaggagcttgatctgagtaaggaagcttttttctttcacgataccccaaaggaggaa
gagtggttcaaagctgtgtcagagggtcttcatccagatgccaaatatgcaaaggtgaag
cttatccgactggttgggattatgctgctgttatatgtcaaacaggagcatgcagcttat
atctcagaagtggaagccgagactgtggggacaggaatcatggggaggatgggcaacaag
ggaggcgtggcgatcaggttccagttccacaacaccagcatctgcgttgtgaattctcac
ttggcagcccacattgaagagtatgagaggaggaaccaggactataaggacatttgttct
cgaatgcagttttgtcagcctgacccaagccttccccctctcaccatcagcaaccatgat
gtgatcttgtggctgggggacctcaactacaggatagaagagctggatgtggaaaaagtg
aaaaagctcatcgaagagaaggactttcaaatgctgtatgcatatgatcagctgaaaatt
caggtggccgcaaagactgtctttgaaggcttcacagagggtgagctcacattccagcct
acttacaagtatgatacgggctctgacgactgggataccagtgagaagtgccgtgctcct
gcctggtgtgatcggattctctggaaagggaagaacatcactcagctgagttaccagagc
cacatggccctgaagaccagtgaccacaagcctgtcagctcagtgtttgacatcggggtg
agggtcgtaaatgacgagctttaccggaagacactggaggaaattgttcgctccctggat
aagatggaaaatgccaacattccttctgtgtccctgtccaagcgagagttctgttttcag
aatgtgaagtacatgcaattgaaagtagaatcctttacaattcataatggacaagtaccc
tgtcattttgaattcatcaacaagcctgatgaagagtcttactgtaagcagtggctgaat
gccaaccccagcagaggcttcctcctgccagattctgatgttgagattgacttggagctc
ttcgtaaataagatgacagctacaaagctcaactcgggtgaagacaaaattgaggacatt
ctggttctgcacttggacaggggaaaggattactttttgtctgtgtctgggaactacctg
cccagctgttttgggtctcccattcatacactgtgttacatgagagagccaatcttggac
ctaccacttgaaaccattagtgagctgactctgatgccagtatggactggagatgatggg
agccagttggatagccccatggaaatccccaaagagctctggatgatggttgattacctg
taccgaaatgctgtccagcaggaagatctgtttcagcaaccaggcctgaggtcagaattt
gaacatatcagggactgcttggatactggaatgattgataacctctctgccagcaatcat
tctgtagccgaagccctgctgcttttcctggagagccttccagagcctgtcatctgttac
agcacctaccataactgcttggagtgttctggcaactacacagcaagcaaacaggtcatt
tctactctccccatattccacaaaaatgtcttccactacttgatggcgtttttgcgagaa
ctgctgaaaaattcagcaaaaaatcatttggatgagaatattctagctagcatatttggc
agcttattgcttcgaaacccagctggtcaccaaaagcttgatatgacagagaagaagaag
gctcaagaatttattcaccagttcctctgcaacccactctga

KEGG   Homo sapiens (human): 4952
Entry
4952              CDS       T01001                                 
Symbol
OCRL, DENT2, Dent-2, INPP5F, LOCR, NPHL2, OCRL-1, OCRL1
Name
(RefSeq) OCRL inositol polyphosphate-5-phosphatase
  KO
K01099  inositol polyphosphate 5-phosphatase INPP5B/F [EC:3.1.3.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Disease
H00692  Lowe syndrome
H00694  Dent disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4952 (OCRL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4952 (OCRL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4952 (OCRL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     4952 (OCRL)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    4952 (OCRL)
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    4952 (OCRL)
  Rab GTPases and associated proteins
   Rab associated proteins
    4952 (OCRL)
 Protein recycling
   Other Rab GTPase associated proteins
    4952 (OCRL)
 Endosome - Golgi transport
   Rab associated proteins
    4952 (OCRL)
SSDB
Motif
Pfam: OCRL_clath_bd RhoGAP Exo_endo_phos INPP5B_PH
Other DBs
NCBI-GeneID: 4952
NCBI-ProteinID: NP_000267
OMIM: 300535
HGNC: 8108
Ensembl: ENSG00000122126
Vega: OTTHUMG00000022706
Pharos: Q01968(Tbio)
UniProt: Q01968
Structure
LinkDB
Position
X:129540259..129592556
AA seq 901 aa
MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINS
HFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQ
LLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPP
PFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQTF
RFFVGTWNVNGQSPDSGLEPWLNCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSMA
VERGLHSKAKYKKVQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMGKMGNKGGVAV
RFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHEVVIWL
GDLNYRLCMPDANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYD
SKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDE
RRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFS
FIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLH
LDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQM
VPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETI
PGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLM
AFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEE
D
NT seq 2706 nt   +upstreamnt  +downstreamnt
atggagccgccgctcccggtcggagcccagccgcttgccactgtcgagggtatggagatg
aagggtcctctccgggagccctgcgccctgaccctagcccagaggaacgggcaatatgag
ttaataatccagttgcatgagaaggaacagcatgttcaagatatcattcctataaatagc
cacttcagatgtgttcaagaagcagaagaaactcttttgattgacatagcttctaacagt
ggctgcaaaattcgggttcagggggactggatcagagagcgccgctttgaaatccctgat
gaggaacactgtttgaagttcctctcagctgtccttgctgctcagaaagctcagtcacag
cttcttgttccagagcaaaaggactcatctagctggtaccagaaattagacactaaggac
aaaccttctgttttttcagggcttcttggatttgaagacaatttttcttctatgaatttg
gacaagaaaataaattcacaaaatcagcctactgggattcatcgggaacccccacctcca
cccttttcagtgaataaaatgcttccacgtgaaaaagaagcttctaacaaggagcagccc
aaagtgaccaacaccatgcggaagctctttgtaccaaatacccaatctgggcagcgggag
ggtctcatcaaacatatcctggcaaagcgagagaaagaatatgtcaacattcagactttc
agattttttgttggaacttggaatgtgaatggccagtctccagatagcgggttagaacct
tggctgaactgtgatcccaatcctcctgatatctactgcattggattccaagaactggac
ttgagcacagaagccttcttctactttgaatctgtgaaggaacaagaatggtccatggct
gtagagagaggtttgcattccaaagccaagtataagaaagttcaactggtgcgccttgtt
gggatgatgcttcttatatttgccagaaaggatcagtgtcgatacattcgtgatattgct
acagaaacagttggaactggaatcatggggaaaatgggaaacaaaggtggggtagctgtg
agatttgtatttcacaacaccaccttttgcattgtcaattcccatctggctgcacacgtg
gaggactttgagagaaggaatcaagattataaggacatttgtgcgagaatgagttttgtg
gtcccaaatcagaccctcccgcagttgaacatcatgaaacatgaggttgtcatttggttg
ggagatttgaattatagactttgcatgcctgatgccaatgaggtgaaaagtcttattaat
aagaaagaccttcagagactcttgaaattcgaccagctaaatattcagcgcacacagaaa
aaagcttttgttgacttcaatgaaggggaaatcaagttcatccccacttataagtatgac
tctaaaacagaccggtgggattccagtgggaaatgccgggttccagcctggtgtgaccga
attctttggagaggaacaaatgttaatcagcttaattatcggagtcacatggaactgaaa
accagcgaccacaagcctgttagcgccctcttccatattggggtgaaggttgtggatgaa
cgaaggtaccggaaagtctttgaagatagtgtacgcatcatggacagaatggaaaatgac
ttccttccttccttagaactcagcaggagggagtttgtgtttgaaaatgtgaagtttcgg
caactacaaaaggagaagttccagatcagcaacaatggacaggttccctgccatttttct
ttcatccctaaacttaatgacagccagtactgcaagccatggcttcgggctgaacctttt
gagggctacttggagccaaatgagacagtggacatttctcttgatgtgtatgtcagcaaa
gactctgtaaccatcctgaactcgggagaagataagattgaagatattctcgtccttcac
ctggatcgaggcaaagattacttcttgactatcagtggaaattacctcccaagttgtttt
ggcacatccttagaggctctgtgccgtatgaaaagaccaatccgagaagttcctgttacc
aaactcatagacttggaagaagacagcttcctagaaaaggagaaatcccttctgcaaatg
gttcctttggatgaaggtgccagtgagagaccccttcaggttcccaaggagatctggctt
ctagtagatcacctattcaaatacgcctgtcaccaggaggacctgttccagacccctgga
atgcaggaagagctccagcagatcattgattgtctggataccagcattcctgagacaatc
cctggcagcaaccactctgtggctgaagcactgctcattttcttggaagccctgccagag
ccagtcatctgttacgagctgtatcagcgatgtcttgactctgcttatgatccccggatc
tgccgacaggtgatctcccagcttccgagatgccatagaaatgttttccgttacttgatg
gcattccttcgagaactcttaaaattctctgaatacaatagcgtcaatgccaacatgatc
gctactctcttcactagtcttctcctgaggcctccacccaaccttatggcaagacagact
ccaagtgaccgccagcgtgctattcagttccttctgggctttctgcttgggagcgaagaa
gactaa

KEGG   Homo sapiens (human): 56623
Entry
56623             CDS       T01001                                 
Symbol
INPP5E, CORS1, CPD4, JBTS1, MORMS, PPI5PIV, pharbin
Name
(RefSeq) inositol polyphosphate-5-phosphatase E
  KO
K20278  inositol polyphosphate 5-phosphatase INPP5E [EC:3.1.3.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Disease
H00530  Joubert syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    56623 (INPP5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    56623 (INPP5E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     56623 (INPP5E)
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-GeneID: 56623
NCBI-ProteinID: NP_063945
OMIM: 613037
HGNC: 21474
Ensembl: ENSG00000148384
Vega: OTTHUMG00000020927
Pharos: Q9NRR6(Tbio)
UniProt: Q9NRR6
Structure
LinkDB
Position
9:complement(136428619..136439845)
AA seq 644 aa
MPSKAENLRPSEPAPQPPEGRTLQGQLPGAPPAQRAGSPPDAPGSESPALACSTPATPSG
EDPPARAAPIAPRPPARPRLERALSLDDKGWRRRRFRGSQEDLEARNGTSPSRGSVQSEG
PGAPAHSCSPPCLSTSLQEIPKSRGVLSSERGSPSSGGNPLSGVASSSPNLPHRDAAVAG
SSPRLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPR
SPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLASGALLGADELARYFPDRNVA
LFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWETRLQETLGPHY
VLLSSAAHGVLYMSLFIRRDLIWFCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLF
ITSHFTSGDGKVAERLLDYTRTVQALVLPRNVPDTNPYRSSAADVTTRFDEVFWFGDFNF
RLSGGRTVVDALLCQGLVVDVPALLQHDQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGK
DTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRD
NIPLAAGKFDRELYLLGIKRRISKEIQRQQALQSQNSSTICSVS
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgccgtccaaggcggagaatctgcggccctccgagccggccccgcagccgccggaaggg
aggacgctccaaggacagcttcccggcgctccgccggcccagcgcgcggggtccccaccc
gatgctccgggctccgagagccccgcgcttgcctgcagcactccggccacgcccagcggc
gaggacccgccagcccgagcagcacccatcgccccgcggccccccgccaggcctcgactg
gagcgagccctgtccctggacgacaagggctggaggaggaggcgttttcgaggcagccag
gaggacctggaagcccggaatgggaccagtccctccaggggctcagtgcagagcgagggc
cccggggcccccgcccacagctgctccccgccctgcctgagcacctccttgcaggaaatc
cccaagtcccgcggggtcctgagcagtgagagagggagcccgtcctcggggggtaaccct
ctctctggggtggccagcagctccccgaacctcccgcacagagacgccgccgtggcgggg
agctcgcccaggctgcccagcctgctgcccccgcgcccaccgcctgccctgagcctggac
atcgcctccgactccctgaggacagcaaacaaggtcgactcggatcttgcagactacaag
ctccgcgcgcagccgctcctggtgcgggcccacagcagcctgggccccggccggccgcgg
agccccctggcctgcgacgactgttcccttcgctcggccaaatcctccttcagcctcctg
gcgcccatccgcagcaaggacgtccgcagcaggagttacctggagggcagcctcctggcc
agcggggccctgttgggggcggatgagctggcccgctacttcccagaccggaacgtggca
ctcttcgtggccacctggaacatgcagggccagaaggagctcccgcccagcctggacgag
ttcctgctcccagccgaggccgactatgcccaggacctgtatgtcatcggggtccaggag
ggctgttctgacaggcgggagtgggagactcgtctgcaggagacgctgggcccgcactat
gtgctgctgtcctcggcggcccacggcgtgctctacatgtcgctcttcatccgcagggac
ctcatctggttctgctcagaggtggagtgctccacggtgaccacacgcatcgtgtctcag
atcaagaccaagggggccttgggcatcagcttcaccttttttggcacttccttcctcttc
atcacgtcccacttcacctcaggtgacgggaaggtggcggagcggctgctggactacacc
aggactgtacaagccctggtcctgcccagaaatgtgcccgacaccaacccctatcgctcc
agcgcagcggacgtcaccacccgcttcgatgaggtgttctggtttggagacttcaacttc
cgcctgagtggcgggcgcacagtcgtggacgccctcctgtgccagggcctggtggtggac
gtgccggcgctgctgcagcacgaccagctcatccgggagatgcggaaagggtccatcttc
aagggcttccaggagccggacatccacttcctcccatcatacaagtttgacatcgggaag
gacacgtacgacagcacctccaagcagaggacgccctcatacacggaccgcgtcttgtac
agaagccgccacaagggtgacatctgtcctgtgagctactcttcctgccccgggatcaag
acgtccgaccaccgccctgtgtatggcctcttccgggtgaaagtgaggccggggcgagac
aacattccgttggcagctggcaaatttgatagagaactgtacttactaggaattaaaaga
cggatttcgaaggagattcagaggcagcaagcactacagagtcagaactccagcaccatc
tgctccgtttcttga

KEGG   Homo sapiens (human): 8867
Entry
8867              CDS       T01001                                 
Symbol
SYNJ1, DEE53, EIEE53, INPP5G, PARK20
Name
(RefSeq) synaptojanin 1
  KO
K20279  synaptojanin [EC:3.1.3.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Disease
H00606  Early infantile epileptic encephalopathy
H01600  Parkinsonian syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8867 (SYNJ1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8867 (SYNJ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8867 (SYNJ1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     8867 (SYNJ1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    8867 (SYNJ1)
SSDB
Motif
Pfam: Syja_N DUF1866 Exo_endo_phos RRM_1
Other DBs
NCBI-GeneID: 8867
NCBI-ProteinID: NP_003886
OMIM: 604297
HGNC: 11503
Ensembl: ENSG00000159082
Vega: OTTHUMG00000064926
Pharos: O43426(Tbio)
UniProt: O43426 J3KQV8 Q05CZ1
Structure
LinkDB
Position
21:complement(32628759..32728040)
AA seq 1612 aa
MRKRWACWSGSDAPGGCGGGCGRRRRRSRRKRAASEERRMAFSKGFRIYHKLDPPPFSLI
VETRHKEECLMFESGAVAVLSSAEKEAIKGTYSKVLDAYGLLGVLRLNLGDTMLHYLVLV
TGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDL
SLNAHRSMQEQTTDNRFFWNQSLHLHLKHYGVNCDDWLLRLMCGGVEIRTIYAAHKQAKA
CLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVVYLDDSVSSFIQIRGSVPLFWEQPG
LQVGSHRVRMSRGFEANAPAFDRHFRTLKNLYGKQIIVNLLGSKEGEHMLSKAFQSHLKA
SEHAADIQMVNFDYHQMVKGGKAEKLHSVLKPQVQKFLDYGFFYFNGSEVQRCQSGTVRT
NCLDCLDRTNSVQAFLGLEMLAKQLEALGLAEKPQLVTRFQEVFRSMWSVNGDSISKIYA
GTGALEGKAKLKDGARSVTRTIQNNFFDSSKQEAIDVLLLGNTLNSDLADKARALLTTGS
LRVSEQTLQSASSKVLKSMCENFYKYSKPKKIRVCVGTWNVNGGKQFRSIAFKNQTLTDW
LLDAPKLAGIQEFQDKRSKPTDIFAIGFEEMVELNAGNIVSASTTNQKLWAVELQKTISR
DNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTT
SLCFVCSHFAAGQSQVKERNEDFIEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEE
VKELIRQQNWDSLIAGDQLINQKNAGQVFRGFLEGKVTFAPTYKYDLFSDDYDTSEKCRT
PAWTDRVLWRRRKWPFDRSAEDLDLLNASFQDESKILYTWTPGTLLHYGRAELKTSDHRP
VVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVLVSIKSSLPENNFFDDALIDELLQQ
FASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEM
SLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTS
PSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQSSPIDAQPATPLPQKDPAQ
PLEPKRPPPPRPVAPPTRPAPPQRPPPPSGARSPAPTRKEFGGIGAPPSPGVARREMEAP
KSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPPRAGVISAPQSHARASAGRLTP
ESQSKTSETSKGSTFLPEPLKPQAAFPPQSSLPPPAQRLQEPLVPVAAPMPQSGPQPNLE
TPPQPPPRSRSSHSLPSEASSQPQVKTNGISDGKRESPLKIDPFEDLSFNLLAVSKAQLS
VQTSPVPTPDPKRLIQLPSATQSNVLSSVSCMPTMPPIPARSQSQENMRSSPNPFITGLT
RTNPFSDRTAAPGNPFRAKSEESEATSWFSKEEPVTISPFPSLQPLGHNKSRASSSLDGF
KDSFDLQGQSTLKISNPKGWVTFEEEEDFGVKGKSKSACSDLLGNQPSSFSGSNLTLNDD
WNKGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTLASKASPTLDFTER
NT seq 4839 nt   +upstreamnt  +downstreamnt
atgcggaagagatgggcctgctggagcggaagtgacgctcccggcggctgtggcggcggc
tgcgggagaaggaggaggaggagccggaggaagagggctgcctccgaagaaaggagaatg
gcgttcagtaaaggattccggatctatcacaaattggatcccccacctttcagcctcata
gtggaaactaggcataaggaagaatgtctcatgttcgagtctggggctgtcgctgtgctc
tcatctgcagaaaaagaggcaatcaagggtacatactccaaagtactggatgcatatgga
ctcttaggtgttctgcggttaaatcttggtgatactatgttacattatctggtcctagtc
actggatgtatgtctgttggaaaaattcaagaatctgaagttttccgagttacttccact
gagtttatatcactgcgaatcgattcttcagatgaggatcgcatttcagaagtgcggaaa
gttttgaattcaggaaacttttattttgcatggtctgcatctggcatcagtttagatttg
agtcttaatgcgcatcgtagcatgcaagaacagacaactgataatagatttttctggaat
cagtctttgcatttgcatctcaaacactatggcgtgaattgtgatgactggttattacgt
cttatgtgtggaggagtagaaatcagaacaatttatgctgctcataaacaggcgaaggct
tgcctcatttcaagattaagctgtgaacgagctgggaccaggtttaatgtccggggaaca
aatgatgatggtcatgttgccaattttgtagaaacagaacaggttgtgtacttagatgac
tcagtttcttccttcatacaaatccgaggatctgttccattgttctgggagcaaccaggg
ttgcaagtgggatctcatcgtgtccgtatgtcaaggggatttgaagccaatgcacctgct
tttgacaggcattttagaacacttaagaacttatatggtaaacaaataatagtaaatttg
cttggatctaaggaaggtgaacatatgctaagtaaagctttccagagtcatttgaaagct
tctgaacatgctgctgatatccagatggtgaattttgactatcatcaaatggttaaggga
ggaaaggcagaaaaattacatagtgttcttaaacctcaagtccagaagtttctagattat
ggatttttttatttcaatggaagtgaagttcaaagatgccagagtggtacagttcgaaca
aactgcttggattgtcttgatagaacaaatagtgtgcaggcatttcttggcttagagatg
ctagctaaacagttggaagctcttggtttagctgaaaagcctcagttggtgactcgcttt
caagaagtttttcggtcaatgtggtccgtgaatggtgattcaatcagtaagatatatgca
ggaactggagctcttgaagggaaagcgaagttaaaagatggtgctcgctctgttacccga
acaattcagaataacttctttgacagctccaagcaagaggccattgatgttttgctactg
ggaaatactctgaatagtgatttagctgacaaagctcgagcacttttaactactggaagt
ttgcgtgtttctgagcagacattacagtcagcatcttctaaagtactaaagagcatgtgt
gagaatttctacaaatattcaaagcctaagaaaattcgagtatgtgtcggaacctggaat
gtgaatggtgggaagcaatttcgcagcatagcttttaagaatcagacactcactgactgg
cttcttgatgcacccaagttagctggcatccaggagtttcaagataaaagaagtaagcca
actgatatatttgcaattggttttgaagaaatggtagaattgaatgctggaaacattgtg
agtgcaagcacaacaaatcagaagctctgggctgtagaacttcagaagacaatctccaga
gacaacaagtatgtgctgctggcttctgaacagttggtgggcgtctgtttgtttgttttt
atcagaccacagcatgctccttttatcagggatgttgcagttgatactgtgaagactgga
atgggaggtgcaactggaaataagggagcagttgcaatccgaatgctcttccatacaacc
agcctttgcttcgtctgtagccactttgctgcagggcagtcacaagtcaaagaaagaaat
gaagattttatagaaatagcacgaaaattgagttttcctatgggaaggatgctattttcc
catgactatgtattttggtgtggtgatttcaactatcgaatcgatctccctaacgaagaa
gttaaagagctcataagacagcaaaattgggattctcttatagcaggagatcaacttatc
aatcagaaaaatgctggacaggtttttagaggatttttagaaggaaaggtaacctttgct
ccgacatataagtatgacttgttttctgacgactatgacaccagtgaaaagtgccgcacc
cctgcctggacagaccgtgtcctttggagaaggaggaaatggccttttgatagatcagct
gaagatctagatcttctaaatgctagttttcaagatgaaagcaaaattctgtacacgtgg
actccaggcactttgctgcactatggaagagctgagctgaagacttctgaccacaggcct
gtcgttgccctgattgatatagatatatttgaagttgaagctgaagagaggcaaaacatt
tataaagaagtaattgcagttcagggtccaccagatggtacagtattggtctcaatcaaa
agttctttaccagaaaataatttttttgatgatgccttgattgatgagcttctgcagcag
tttgcaagttttggtgaagttatacttataagatttgtagaagataaaatgtgggttaca
tttttggagggaagctctgccttgaatgttctgagcctaaatggtaaagagttattgaat
cggactataactattgctttaaaaagtccagactggatcaaaaatttggaagaagaaatg
agtttagagaaaattagcattgcattgccatcatcaacaagctctaccctgcttggtgaa
gatgcagaggttgcagcagattttgatatggaaggtgatgttgatgactatagtgctgaa
gtggaggaacttcttcctcagcatctccagccatcttcaagttccggccttggtacttcc
cccagctcttcaccccgaactagtccctgccagtcacctacaatatcagagggtcctgta
ccttcccttcccatcagaccaagccgagcaccgtcaagaactcctgggcctcccagtgca
cagagttctcctattgacgcgcagccagcaacgccgctgccgcagaaagaccccgcccag
cccttggagcccaagcggccgccgccgccccgcccggtcgcccctcccacacgcccggct
cccccacagagacctcctccgccttcaggggctaggagtcctgcacccactagaaaggaa
tttggaggtattggagcccctcccagtcctggggtagctaggagagagatggaagcaccc
aaaagccctggaacaacaaggaaagataatataggacgcagtcagccttcacctcaagca
ggacttgcaggcccaggacctgctggatacagtacagccagaccgacgattcctcctcgt
gctggagttatcagtgccccacagagccacgcgcgggcatctgctggaagactgactcct
gaaagccaaagcaaaacatcagaaacgtcgaaaggttcaactttccttcctgaaccactg
aagcctcaggctgcttttcctccgcagtcttctttgcccccgcctgctcaaaggttgcaa
gagcctcttgtccctgtggcagcacctatgcctcagtctggcccccagccaaatttggaa
accccaccacaaccaccacctcgaagcaggtcatcccatagcttgccttcagaagcttcc
tcacaaccgcaagtaaaaacaaatggaatctctgatggcaaaagagaatcaccattaaag
attgacccatttgaagatctgtcatttaatctgcttgctgtatcaaaggctcagctatct
gttcaaacgtcacctgttcccaccccagacccaaagaggttgattcagttgccttctgca
acgcaaagtaatgttttgagttctgtaagttgcatgccaacaatgcctccaattccagct
cggagtcaatcccaggaaaatatgcgaagttctccaaacccatttattactggcttgacc
aggacaaatcctttcagtgacaggactgctgctcctggaaacccatttagagccaagtct
gaagaatcagaggcaacttcatggttctccaaagaagagcccgttactatcagtcctttc
ccttctctgcagcctcttggtcataacaaaagcagggcttcatcttcacttgatggcttt
aaggacagttttgatctacagggccagtctacattaaaaattagcaacccgaaaggatgg
gtaaccttcgaggaagaagaggattttggtgtgaaagggaagtcaaagtcagcttgttca
gacttactgggtaatcagccaagttcattttctggctccaacctgacattgaatgatgac
tggaataaaggtacaaatgtctccttctgtgtgttgccgtcaagaagacctcctccacct
cctgtccctctgctcccgcccggcaccagccctccagtagatcctttcacgaccttggcc
tctaaggcttcacccacactggactttacagaaagataa

KEGG   Homo sapiens (human): 8871
Entry
8871              CDS       T01001                                 
Symbol
SYNJ2, INPP5H
Name
(RefSeq) synaptojanin 2
  KO
K20279  synaptojanin [EC:3.1.3.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8871 (SYNJ2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8871 (SYNJ2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8871 (SYNJ2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     8871 (SYNJ2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    8871 (SYNJ2)
SSDB
Motif
Pfam: Syja_N DUF1866 Exo_endo_phos
Other DBs
NCBI-GeneID: 8871
NCBI-ProteinID: NP_003889
OMIM: 609410
HGNC: 11504
Ensembl: ENSG00000078269
Vega: OTTHUMG00000015904
Pharos: O15056(Tbio)
UniProt: O15056 B4DG94
Structure
LinkDB
Position
6:157981296..158099176
AA seq 1496 aa
MALSKGLRLLGRLGAEGDCSVLLEARGRDDCLLFEAGTVATLAPEEKEVIKGQYGKLTDA
YGCLGELRLKSGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL
KKILSSGVFYFSWPNDGSRFDLTVRTQKQGDDSSEWGNSFFWNQLLHVPLRQHQVSCCDW
LLKIICGVVTIRTVYASHKQAKACLVSRVSCERTGTRFHTRGVNDDGHVSNFVETEQMIY
MDDGVSSFVQIRGSVPLFWEQPGLQVGSHHLRLHRGLEANAPAFDRHMVLLKEQYGQQVV
VNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMINFDFHQFAKGGKLEKLETLLRPQLKLH
WEDFDVFTKGENVSPRFQKGTLRMNCLDCLDRTNTVQSFIALEVLHLQLKTLGLSSKPIV
DRFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFFDGVKQEA
IKLLLVGDVYGEEVADKGGMLLDSTALLVTPRILKAMTERQSEFTNFKRIRIAMGTWNVN
GGKQFRSNVLRTAELTDWLLDSPQLSGATDSQDDSSPADIFAVGFEEMVELSAGNIVNAS
TTNKKMWGEQLQKAISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGG
KAGNKGAVGIRFQFHSTSFCFICSHLTAGQSQVKERNEDYKEITQKLCFPMGRNVFSHDY
VFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEFDQLQLQKSSGKIFKDFHEGAINFGPTY
KYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPFDKTAGELNLLDSDLDVDTKVRHTWSPG
ALQYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSFQGPLDATVVVNLQSPT
LEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRA
VKIRPKTKDWLKGLREEIIRKRDSMAPVSPTANSCLLEENFDFTSLDYESEGDILEDDED
YLVDEFNQPGVSDSELGGDDLSDVPGPTALAPPSKSPALTKKKQHPTYKDDADLVELKRE
LEAVGEFRHRSPSRSLSVPNRPRPPQPPQRPPPPTGLMVKKSASDASISSGTHGQYSILQ
TARLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGASEEALSAVAP
RDLEASSEPEPTPGAAKPETPQAPPLLPRRPPPRVPAIKKPTLRRTGKPLSPEEQFEQQT
VHFTIGPPETSVEAPPVVTAPRVPPVPKPRTFQPGKAAERPSHRKPASDEAPPGAGASVP
PPLEAPPLVPKVPPRRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQ
GDFLSTSSATSPDSDGTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSG
TRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAKT
NT seq 4491 nt   +upstreamnt  +downstreamnt
atggccctgagcaaagggctgcggctgctggggcgcctgggggccgagggggactgtagc
gtgctgctggaggcgcgcggccgcgacgactgcctgctgttcgaggccggcacggtggcc
acgctggctccagaagaaaaggaagtcattaaaggacagtatggcaagctcacggacgcg
tacggctgcctgggggagctgaggctgaaatctggtggcacgtctctgagcttcctggtg
ttggtgacaggctgcacatctgtgggcagaattccagatgctgaaatctacaaaatcact
gccactgacttttaccctcttcaggaagaggccaaggaggaggaacgcctcatagctttg
aagaaaatcctcagctcgggggtgttctatttctcatggccaaacgatgggtctcgcttt
gacctgactgtccgcacgcagaagcagggggatgacagctctgaatgggggaactccttc
ttctggaaccagctgttgcacgtgcccttgaggcagcaccaggtgagctgctgtgactgg
ctgctgaagatcatctgcggggtggtcaccatccgcaccgtgtatgcctcccacaagcag
gccaaggcctgcctcgtctctcgcgttagctgtgagcgcacaggcactcgcttccacacc
cgtggcgtgaacgacgacggccatgtgtccaacttcgtggagacagagcagatgatttac
atggacgatggagtgtcatcttttgtccagatcagaggctccgttccgctgttctgggaa
cagccagggcttcaggttggctcccatcatctgagactccacagaggcctggaagccaat
gcccctgctttcgacaggcacatggtgcttctgaaggagcagtacgggcagcaggtggtc
gtgaaccttctgggaagcagaggcggagaggaggtgctcaacagagccttcaagaagctg
ctctgggcttcttgccacgcgggcgacacgcctatgatcaattttgacttccatcagttt
gccaaaggtgggaagctagagaaattggagaccctcttgaggccacagttaaagctgcac
tgggaagacttcgatgtgttcacaaagggggagaacgtcagtccacgttttcagaaaggc
actttgcggatgaactgtcttgactgcctggaccgaaccaacactgtgcagagcttcatc
gcgctcgaggtcctgcatctgcagctcaagaccctggggctgagttcaaaacccatcgtt
gaccgctttgtggagtccttcaaagccatgtggtctctgaatggccacagcctgagcaag
gtgttcacaggcagcagagccctggaagggaaggccaaggtggggaagctgaaggatgga
gcccggtccatgtctcgaaccatccagtccaacttcttcgacggggtgaagcaggaggcc
atcaagctgctgctggttggggacgtctacggcgaggaggtggcagacaaagggggcatg
ctgctggacagcacggcgctcctggtgactcccaggatcctgaaagctatgactgagcgt
cagtccgaattcacaaatttcaagcggatccggattgctatggggacctggaacgtgaac
ggaggaaagcagttccggagcaacgtgctcaggacggcggagctgacagactggctgctc
gactcgccccagctctcgggagctaccgactcccaggatgacagcagcccagctgacata
tttgctgtggggtttgaagagatggtggaattgagcgcagggaatattgtcaatgccagt
actaccaacaagaagatgtggggtgaacagcttcagaaagccatctcacgctctcataga
tacattctgttgacttcggcacagctggtgggcgtctgtctttatatctttgtacgtcca
taccatgtcccgttcatcagggacgtagccatcgacacagtgaagacgggcatggggggc
aaggcggggaacaagggcgccgtcggcatccgcttccagttccacagcaccagcttctgc
ttcatatgtagtcacctgacggccgggcagtcccaggtgaaggagcggaatgaagactac
aaggagatcacccagaaactctgcttcccaatggggagaaatgttttttctcatgattat
gtattttggtgtggcgatttcaactaccgcattgatcttacttatgaagaagtcttctat
tttgttaaacgccaagactggaagaaacttctggaatttgatcaactacagctacagaaa
tcaagtggaaaaatttttaaggactttcacgaaggagccattaactttggacccacctac
aagtatgacgttggctcagccgcctacgatacaagcgacaaatgccgcacccccgcctgg
acagacagggtgctgtggtggaggaagaaacatccctttgataaaacagctggagaactc
aaccttctagacagtgatctagatgttgacaccaaagtcagacacacctggtctcctggt
gccctgcagtattatggtcgtgcggagctacaagcgtctgatcacagacctgtgctggcg
atcgtggaggtggaagttcaggaagtcgatgtgggtgctcgggagagggttttccaggaa
gtgtcctccttccagggccccctggatgccactgttgtagtaaaccttcaatcaccgacc
ttagaagagaaaaacgagtttccagaggacctgcgtactgagctcatgcagaccttgggg
agttatgggacaattgttcttgtcaggatcaaccaagggcagatgctggtaacttttgca
gacagtcactcggctctcagtgtcctggacgtggacggtatgaaggtgaaaggcagagca
gtgaagattagaccgaagaccaaggactggctgaaaggtttgcgagaggagatcattcgg
aaacgagacagcatggcccccgtgtctcccactgccaactcctgtttgctggaggaaaac
tttgacttcacaagtttggactatgagtcagaaggggatattcttgaagacgatgaagac
tacttggtggatgaattcaatcagcctggagtctcggacagtgaactcgggggagacgac
ctctctgatgtccccggccccacagcactggctcctcccagcaagtcacctgctctcacc
aaaaagaagcagcatccaacgtacaaagatgacgcggacctggtggagctcaagcgggag
ctggaagccgtcggggagttccgccaccgttctccgagcaggtctctgtcggtccccaac
cggcctcggccacctcaacccccgcagagacccccccctccaaccggtttaatggtgaaa
aagtcggcttcagatgcgtccatctcctccggcacccatggacagtattcaattttgcag
acggcaagacttctaccaggagcacctcagcaacctcccaaggctcggactggaataagt
aaaccttataatgtcaagcagatcaaaaccaccaatgcccaggaggcagaagcagcaatc
cggtgtctcctggaagccagaggaggtgcctccgaagaagccctaagtgccgtggcccca
agggaccttgaagcatcctctgaaccagagcccacaccgggggcagccaaaccagagacc
ccacaggcgcccccactccttccccgtcggcccccacccagagttcctgccatcaagaag
ccaaccttgagaaggacaggaaagcccctgtcaccggaagaacagtttgagcaacagact
gtccattttacaatcgggcccccggagacaagcgttgaggcccctcctgtcgtgacagcc
cctcgagtccctcctgttcccaaaccaagaacatttcagcctgggaaagctgcagagagg
ccaagccacaggaagccagcatcagacgaagcccctcctggggcaggagcctctgtgcca
ccacctctggaggcgccgcctcttgtgcccaaggtacccccgaggaggaagaagtcagcc
cccgcagccttccacctgcaggtcctgcagagcaacagccagcttctccagggcctcact
tacaatagcagtgacagcccctctgggcacccacctgccgcgggcaccgtcttcccacaa
ggggactttctcagcacttcatctgctacaagccccgacagcgatggcaccaaagcgatg
aagccagaggcagccccacttcttggtgattatcaggaccccttctggaaccttcttcac
caccctaaactgttgaataacacttggctttctaagagctcagaccctttggactcagga
accaggagccccaaaagagatcccatagacccagtgtcagctggcgcttcagctgccaag
gcagagctgccaccagatcatgaacacaaaaccttaggtcactgggtgacaatcagtgac
caagaaaagaggacagcactgcaggtgtttgacccactggcaaaaacatga

DBGET integrated database retrieval system