KEGG   Homo sapiens (human): 3777
Entry
3777              CDS       T01001                                 
Symbol
KCNK3, K2p3.1, OAT1, PPH4, TASK, TASK-1, TASK1, TBAK1
Name
(RefSeq) potassium two pore domain channel subfamily K member 3
  KO
K04914  potassium channel subfamily K member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
Disease
H01619  Primary pulmonary hypertension
H01621  Pulmonary arterial hypertension
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    3777 (KCNK3)
   04927 Cortisol synthesis and secretion
    3777 (KCNK3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    3777 (KCNK3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3777 (KCNK3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   3777 (KCNK3)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans GP38 SelK_SelG
Other DBs
NCBI-GeneID: 3777
NCBI-ProteinID: NP_002237
OMIM: 603220
HGNC: 6278
Ensembl: ENSG00000171303
Vega: OTTHUMG00000125530
Pharos: O14649(Tclin)
UniProt: O14649
Structure
LinkDB
Position
2:26692722..26733420
AA seq 394 aa
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaagcggcagaacgtgcgcacgctggcgctcatcgtgtgcaccttcacctacctgctg
gtgggcgccgcggtcttcgacgcgctggagtcggagcccgagctgatcgagcggcagcgg
ctggagctgcggcagcaggagctgcgggcgcgctacaacctcagccagggcggctacgag
gagctggagcgcgtcgtgctgcgcctcaagccgcacaaggccggcgtgcagtggcgcttc
gccggctccttctacttcgccatcaccgtcatcaccaccatcggctacgggcacgcggca
cccagcacggatggcggcaaggtgttctgcatgttctacgcgctgctgggcatcccgctc
acgctcgtcatgttccagagcctgggcgagcgcatcaacaccttggtgaggtacctgctg
caccgcgccaagaaggggctgggcatgcggcgcgccgacgtgtccatggccaacatggtg
ctcatcggcttcttctcgtgcatcagcacgctgtgcatcggcgccgccgccttctcccac
tacgagcactggaccttcttccaggcctactactactgcttcatcaccctcaccaccatc
ggcttcggcgactacgtggcgctgcagaaggaccaggccctgcagacgcagccgcagtac
gtggccttcagcttcgtctacatccttacgggcctcacggtcatcggcgccttcctcaac
ctcgtggtgctgcgcttcatgaccatgaacgccgaggacgagaagcgcgacgccgagcac
cgcgcgctgctcacgcgcaacgggcaggcgggcggcggcggagggggtggcagcgcgcac
actacggacaccgcctcatccacggcggcagcgggcggcggcggcttccgcaacgtctac
gcggaggtgctgcacttccagtccatgtgctcgtgcctgtggtacaagagccgcgagaag
ctgcagtactccatccccatgatcatcccgcgggacctctccacgtccgacacgtgcgtg
gagcagagccactcgtcgccgggagggggcggccgctacagcgacacgccctcgcgacgc
tgcctgtgcagcggggcgccacgctccgccatcagctcggtgtccacgggtctgcacagc
ctgtccaccttccgcggcctcatgaagcgcaggagctccgtgtga

KEGG   Homo sapiens (human): 51305
Entry
51305             CDS       T01001                                 
Symbol
KCNK9, BIBARS, K2p9.1, KT3.2, TASK-3, TASK3, TASK32
Name
(RefSeq) potassium two pore domain channel subfamily K member 9
  KO
K04919  potassium channel subfamily K member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04925  Aldosterone synthesis and secretion
Disease
H00709  Birk Barel mental retardation syndrome (BBMRS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    51305 (KCNK9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    51305 (KCNK9)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   51305 (KCNK9)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans IRK
Other DBs
NCBI-GeneID: 51305
NCBI-ProteinID: NP_001269463
OMIM: 605874
HGNC: 6283
Ensembl: ENSG00000169427
Vega: OTTHUMG00000164186
Pharos: Q9NPC2(Tclin)
UniProt: Q9NPC2 A0A024R9H3
Structure
LinkDB
Position
8:complement(139600838..139703123)
AA seq 374 aa
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ
CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN
LVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT
CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHS
FTDHQRLMKRRKSV
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgaagaggcagaacgtgcggactctgtccctcatcgtctgcaccttcacctacctgctg
gtgggcgccgccgtgttcgacgccctcgagtcggaccacgagatgcgcgaggaggagaaa
ctcaaagccgaggagatccggatcaaggggaagtacaacatcagcagcgaggactaccgg
cagctggagctggtgatcctgcagtcggaaccgcaccgcgccggcgtccagtggaaattc
gccggctccttctactttgcgatcacggtcatcaccaccataggttatgggcacgctgca
cctggcaccgatgcgggcaaggccttctgcatgttctacgccgtgctgggcatcccgctg
acactggtcatgttccagagcctgggcgagcgcatgaacaccttcgtgcgctacctgctg
aagcgcattaagaagtgctgtggcatgcgcaacactgacgtgtctatggagaacatggtg
actgtgggcttcttctcctgcatggggacgctgtgcatcggggcggccgccttctcccag
tgtgaggagtggagcttcttccacgcctactactactgcttcatcacgttgactaccatt
gggttcggggactacgtggccctgcagaccaagggtgccctgcagaagaagccgctctac
gtggcctttagctttatgtatatcctggtggggctgacggtcatcggggccttcctcaac
ctggtcgtcctcaggttcttgaccatgaacagtgaggatgagcggcgggatgctgaagag
agggcatccctcgccggaaaccgcaacagcatggtcattcacatccctgaggagccgcgg
cccagccggcccaggtacaaggcggacgtcccggacctgcagtctgtgtgctcctgcacc
tgctaccgctcgcaggactatggcggccgctcggtggcaccgcagaactccttcagcgcc
aagcttgccccccactacttccactccatctcttacaagatcgaggagatctcaccaagc
acattaaaaaacagcctcttcccatcgcctattagctccatctctcctgggttacacagc
tttaccgaccaccagaggctgatgaaacgccggaagtccgtttag

DBGET integrated database retrieval system