KEGG   Homo sapiens (human): 388372
Entry
388372            CDS       T01001                                 
Symbol
CCL4L1, AT744.2, CCL4L, LAG-1, LAG1, MIP-1-beta, SCYA4L, SCYA4L1, SCYA4L2
Name
(RefSeq) C-C motif chemokine ligand 4 like 1
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    388372 (CCL4L1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    388372 (CCL4L1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    388372 (CCL4L1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    388372 (CCL4L1)
   04623 Cytosolic DNA-sensing pathway
    388372 (CCL4L1)
   04062 Chemokine signaling pathway
    388372 (CCL4L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    388372 (CCL4L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    388372 (CCL4L1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   388372 (CCL4L1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 388372
NCBI-ProteinID: NP_996890
OMIM: 603782
HGNC: 10631
UniProt: Q8NHW4 P13236 B7ZW36
Structure
LinkDB
Position
17q12
AA seq 92 aa
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRGKQVCADPSESWVQEYVYDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcgtgctagtagctgccttctgctctcta
gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaggcaagcaagtctgcgctgaccccagtgagtcc
tgggtccaggagtacgtgtatgacctggaactgaactga

KEGG   Homo sapiens (human): 414062
Entry
414062            CDS       T01001                                 
Symbol
CCL3L3, 464.2, D17S1718, G0S19-2, LD78, LD78BETA, SCYA3L, SCYA3L1
Name
(RefSeq) C-C motif chemokine ligand 3 like 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    414062 (CCL3L3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    414062 (CCL3L3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    414062 (CCL3L3)
   04062 Chemokine signaling pathway
    414062 (CCL3L3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    414062 (CCL3L3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    414062 (CCL3L3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    414062 (CCL3L3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    414062 (CCL3L3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    414062 (CCL3L3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    414062 (CCL3L3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   414062 (CCL3L3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   414062 (CCL3L3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 414062
NCBI-ProteinID: NP_001001437
OMIM: 609468
HGNC: 30554
Ensembl: ENSG00000276085
UniProt: P16619
LinkDB
Position
17:complement(36194869..36196758)
AA seq 93 aa
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6348
Entry
6348              CDS       T01001                                 
Symbol
CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
Name
(RefSeq) C-C motif chemokine ligand 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01167  VAV vCCI to CCR signaling
N01168  CCL3/7 to HCMV US28 signaling
N01169  CCL3 to HHV6 U12 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Disease
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6348 (CCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6348 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6348 (CCL3)
   04062 Chemokine signaling pathway
    6348 (CCL3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6348 (CCL3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6348 (CCL3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6348 (CCL3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6348 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6348 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6348 (CCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6348 (CCL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6348 (CCL3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6348
NCBI-ProteinID: NP_002974
OMIM: 182283
HGNC: 10627
Ensembl: ENSG00000277632
Pharos: P10147(Tbio)
UniProt: P10147 A0N0R1
Structure
LinkDB
Position
17:complement(36088256..36090143)
AA seq 92 aa
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag
ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacacctcccgg
cagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaagccc
ggtgtcatcttcctaaccaagcgaagccggcaggtctgtgctgaccccagtgaggagtgg
gtccagaaatatgtcagcgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6349
Entry
6349              CDS       T01001                                 
Symbol
CCL3L1, 464.2, D17S1718, G0S19-2, LD78, LD78-beta(1-70), LD78BETA, MIP1AP, SCYA3L, SCYA3L1
Name
(RefSeq) C-C motif chemokine ligand 3 like 1
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Disease
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6349 (CCL3L1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6349 (CCL3L1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6349 (CCL3L1)
   04062 Chemokine signaling pathway
    6349 (CCL3L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6349 (CCL3L1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6349 (CCL3L1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6349 (CCL3L1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6349 (CCL3L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6349 (CCL3L1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6349 (CCL3L1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6349 (CCL3L1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6349 (CCL3L1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6349
NCBI-ProteinID: NP_066286
OMIM: 601395
HGNC: 10628
Pharos: P16619(Tbio)
UniProt: P16619
LinkDB
Position
17q21.1
AA seq 93 aa
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6351
Entry
6351              CDS       T01001                                 
Symbol
CCL4, ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4
Name
(RefSeq) C-C motif chemokine ligand 4
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N01196  CCL3/4/5/8 to CCR5 signaling
N01207  CCL4 to HHV6 U12 signaling
N01212  CCL4 to HCMV US28 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6351 (CCL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6351 (CCL4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6351 (CCL4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6351 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    6351 (CCL4)
   04062 Chemokine signaling pathway
    6351 (CCL4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6351 (CCL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6351 (CCL4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6351 (CCL4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6351
NCBI-ProteinID: NP_002975
OMIM: 182284
HGNC: 10630
Ensembl: ENSG00000275302
Pharos: P13236(Tbio)
UniProt: P13236
Structure
LinkDB
Position
17:36103827..36105614
AA seq 92 aa
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcatgctagtagctgccttctgctctcca
gcgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaagcaagcaagtctgtgctgatcccagtgaatcc
tgggtccaggagtacgtgtatgacctggaactgaactga

KEGG   Homo sapiens (human): 6352
Entry
6352              CDS       T01001                                 
Symbol
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
Name
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
hsa05020  Prion disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00429  HCMV UL22A to CCR5-GNB/G-PLCB/G-PKC signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01182  VAV vCCI to CCR signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
N01184  CCL5 to HHV6 U12 signaling
N01185  CCL5/11 to HHV6 U51 signaling
N01190  CCL5/17/22 to CCR4 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6352 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6352 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6352 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6352 (CCL5)
   04621 NOD-like receptor signaling pathway
    6352 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    6352 (CCL5)
   04062 Chemokine signaling pathway
    6352 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    6352 (CCL5)
   05168 Herpes simplex virus 1 infection
    6352 (CCL5)
   05163 Human cytomegalovirus infection
    6352 (CCL5)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6352 (CCL5)
   05131 Shigellosis
    6352 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6352 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6352 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    6352 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6352 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6352 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6352 (CCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6352 (CCL5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6352 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6352
NCBI-ProteinID: NP_002976
OMIM: 187011
HGNC: 10632
Ensembl: ENSG00000271503
Pharos: P13501(Tchem)
UniProt: P13501 D0EI67
Structure
LinkDB
Position
17:complement(35871491..35880360)
AA seq 91 aa
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctag

KEGG   Homo sapiens (human): 6355
Entry
6355              CDS       T01001                                 
Symbol
CCL8, HC14, MCP-2, MCP2, SCYA10, SCYA8
Name
(RefSeq) C-C motif chemokine ligand 8
  KO
K16596  C-C motif chemokine 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6355 (CCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6355 (CCL8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6355 (CCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6355 (CCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6355 (CCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6355
NCBI-ProteinID: NP_005614
OMIM: 602283
HGNC: 10635
Ensembl: ENSG00000108700
Pharos: P80075(Tbio)
UniProt: P80075
Structure
LinkDB
Position
17:34319435..34321402
AA seq 99 aa
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtttctgcagcgcttctgtgcctgctgctcatggcagccactttcagccctcag
ggacttgctcagccagattcagtttccattccaatcacctgctgctttaacgtgatcaat
aggaaaattcctatccagaggctggagagctacacaagaatcaccaacatccaatgtccc
aaggaagctgtgatcttcaagaccaaacggggcaaggaggtctgtgctgaccccaaggag
agatgggtcagggattccatgaagcatctggaccaaatatttcaaaatctgaagccatga

KEGG   Homo sapiens (human): 9560
Entry
9560              CDS       T01001                                 
Symbol
CCL4L2, AT744.2, CCL4L, SCYA4L, SCYQ4L2
Name
(RefSeq) C-C motif chemokine ligand 4 like 2
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    9560 (CCL4L2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9560 (CCL4L2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    9560 (CCL4L2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    9560 (CCL4L2)
   04623 Cytosolic DNA-sensing pathway
    9560 (CCL4L2)
   04062 Chemokine signaling pathway
    9560 (CCL4L2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    9560 (CCL4L2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9560 (CCL4L2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   9560 (CCL4L2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 9560
NCBI-ProteinID: NP_001278401
OMIM: 610757
HGNC: 24066
Ensembl: ENSG00000276070
Pharos: Q8NHW4(Tdark)
UniProt: Q8NHW4
LinkDB
Position
17:36211063..36212873
AA seq 96 aa
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcgtgctagtagctgccttctgctctcta
gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggttgctgctccgggaaggatcccatccaccagagctgccccacatggacca
tggtcaggcagaggaagatgcctaccacaggcaagggataaagccagatga

DBGET integrated database retrieval system