158 aa
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC
GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF
KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
KEGG Orthology (KO) [BR:hsa00001]
09160 Human Diseases
09161 Cancer: overview
05202 Transcriptional misregulation in cancer
221037 (JMJD1C)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:hsa03036]
221037 (JMJD1C)
Enzymes [BR:hsa01000]
1. Oxidoreductases
1.14 Acting on paired donors, with incorporation or reduction of molecular oxygen
1.14.11 With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
1.14.11.-
221037 (JMJD1C)
Chromosome and associated proteins [BR:hsa03036]
Eukaryotic type
Histone modification proteins
Histone demethylases
221037 (JMJD1C)
KEGG Orthology (KO) [BR:hsa00001]
09160 Human Diseases
09161 Cancer: overview
05202 Transcriptional misregulation in cancer
7403 (KDM6A)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:hsa03036]
7403 (KDM6A)
Enzymes [BR:hsa01000]
1. Oxidoreductases
1.14 Acting on paired donors, with incorporation or reduction of molecular oxygen
1.14.11 With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
1.14.11.68 [histone H3]-trimethyl-L-lysine27 demethylase
7403 (KDM6A)
Chromosome and associated proteins [BR:hsa03036]
Eukaryotic type
Histone modification proteins
HMT complexes
MLL3/MLL4 complex
7403 (KDM6A)
Histone demethylases
7403 (KDM6A)