KEGG   Homo sapiens (human): 405
Entry
405               CDS       T01001                                 

Gene name
ARNT, HIF-1-beta, HIF-1beta, HIF1-beta, HIF1B, HIF1BETA, TANGO, bHLHe2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04934  Cushing syndrome
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05211  Renal cell carcinoma
Network
nt06225  HIF-1 signaling
nt06227  Nuclear receptor signaling
nt06264  Renal cell carcinoma
nt06360  Cushing syndrome
  Element
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00317  AhR signaling pathway
N01365  TCDD to Ahr signaling pathway
N01366  BaP to Ahr signaling pathway
N01367  PCB to Ahr signaling pathway
N01368  HCB to Ahr signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    405 (ARNT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    405 (ARNT)
   05207 Chemical carcinogenesis - receptor activation
    405 (ARNT)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    405 (ARNT)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    405 (ARNT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    405 (ARNT)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    405 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PRAS
Other DBs
NCBI-GeneID: 405
NCBI-ProteinID: NP_001659
OMIM: 126110
HGNC: 700
Ensembl: ENSG00000143437
Vega: OTTHUMG00000035011
Pharos: P27540(Tbio)
UniProt: P27540
LinkDB
Structure
PDB: 

Position
1q21.3
AA seq 789 aa
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKT
RTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
LTMFPPFSE
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggcggcgactactgccaaccccgaaatgacatcagatgtaccatcactgggtccagcc
attgcctctggaaactctggacctggaattcaaggtggaggagccattgtccagagggct
attaagcggcgaccagggctggattttgatgatgatggagaagggaacagtaaatttttg
aggtgtgatgatgatcagatgtctaacgataaggagcggtttgccaggtcggatgatgag
cagagctctgcggataaagagagacttgccagggaaaatcacagtgaaattgaacggcgg
cgacggaacaagatgacagcctacatcacagaactgtcagatatggtacccacctgtagt
gccctggctcgaaaaccagacaagctaaccatcttacgcatggcagtttctcacatgaag
tccttgcggggaactggcaacacatccactgatggctcctataagccgtctttcctcact
gatcaggaactgaaacatttgatcttggaggcagcagatggctttctgtttattgtctca
tgtgagacaggcagggtggtgtatgtgtctgactccgtgactcctgttttgaaccagcca
cagtctgaatggtttggcagcacactctatgatcaggtgcacccagatgatgtggataaa
cttcgtgagcagctttccacttcagaaaatgccctgacagggcgtatcctggatctaaag
actggaacagtgaaaaaggaaggtcagcagtcttccatgagaatgtgtatgggctcaagg
agatcgtttatttgccgaatgaggtgtggcagtagctctgtggacccagtttctgtgaat
aggctgagctttgtgaggaacagatgcaggaatggacttggctctgtaaaggatggggaa
cctcacttcgtggtggtccactgcacaggctacatcaaggcctggcccccagcaggtgtt
tccctcccagatgatgacccagaggctggccagggaagcaagttttgcctagtggccatt
ggcagattgcaggtaactagttctcccaactgtacagacatgagtaatgtttgtcaacca
acagagttcatctcccgacacaacattgagggtatcttcacttttgtggatcaccgctgt
gtggctactgttggctaccagccacaggaactcttaggaaagaatattgtagaattctgt
catcctgaagaccagcagcttctaagagacagcttccaacaggtagtgaaattaaaaggc
caagtgctgtctgtcatgttccggttccggtctaagaaccaagaatggctctggatgaga
accagctcctttactttccagaacccttactcagatgaaattgagtacatcatctgtacc
aacaccaatgtgaagaactctagccaagaaccacggcctacactctccaacacaatccag
aggccacaactaggtcccacagctaatttacccctggagatgggctcaggacagctggca
cccaggcagcagcaacagcaaacagaattggacatggtaccaggaagagatggactggcc
agctacaatcattcccaggtggttcagcctgtgacaaccacaggaccagaacacagcaag
ccccttgagaagtcagatggtttatttgcccaggatagagatccaagattttcagaaatc
tatcacaacatcaatgcggatcagagtaaaggcatctcctccagcactgtccctgccacc
caacagctattctcccagggcaacacattccctcctaccccccggccggcagagaatttc
aggaatagtggcctagcccctcctgtaaccattgtccagccatcagcttctgcaggacag
atgttggcccagatttcccgccactccaaccccacccaaggagcaaccccaacttggacc
cctactacccgctcaggcttttctgcccagcaggtggctacccaggctactgctaagact
cgtacttcccagtttggtgtgggcagctttcagactccatcctccttcagctccatgtcc
ctccctggtgccccaactgcatcgcctggtgctgctgcctaccctagtctcaccaatcgt
ggatctaactttgctcctgagactggacagactgcaggacaattccagacacggacagca
gagggtgtgggtgtctggccacagtggcagggccagcagcctcatcatcgttcaagttct
agtgagcaacatgttcaacaaccgccagcacagcaacctggccagcctgaggtcttccag
gagatgctgtccatgctgggagatcagagcaacagctacaacaatgaagaattccctgat
ctaactatgtttccccccttttcagaatag

KEGG   Homo sapiens (human): 9915
Entry
9915              CDS       T01001                                 

Gene name
ARNT2, WEDAS, bHLHe1
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05211  Renal cell carcinoma
Network
nt06240  Transcription
  Element
N00136  EWSR1-ATF1 fusion to transcriptional activation
Disease
H01797  Webb-Dattani syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9915 (ARNT2)
   05202 Transcriptional misregulation in cancer
    9915 (ARNT2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    9915 (ARNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9915 (ARNT2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    9915 (ARNT2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 9915
NCBI-ProteinID: NP_055677
OMIM: 606036
HGNC: 16876
Ensembl: ENSG00000172379
Vega: OTTHUMG00000165478
Pharos: Q9HBZ2(Tbio)
UniProt: Q9HBZ2 Q7Z3A3 X5DQN9 Q86TN1
LinkDB
Position
15q25.1
AA seq 717 aa
MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGI
GTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQW
QSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggcaaccccggcggcggtcaaccctccggaaatggcttcagacatacctggatctgtg
acgttgcccgttgcccccatggcggccaccggacaggtgaggatggcgggggccatgcct
gcccgtggaggaaagcggcgttccggaatggacttcgatgatgaagatggtgaaggcccc
agtaaattttcaagagagaatcatagtgaaatcgaaaggcgcagacggaacaagatgact
cagtacatcacggagctctccgacatggtccccacatgcagcgcactggctcggaagcca
gacaagctcaccatcctccgcatggccgtctcgcacatgaagtccatgaggggtacaggg
aacaagtccaccgatggcgcgtacaagccttccttcctcacagagcaggaactgaagcat
ctcatccttgaagcagctgatggatttctgtttgtggtggctgctgagacagggcgagtg
atttatgtgtctgactccgtcacccctgttctgaaccagccccagtcagagtggtttggg
agcacactgtatgaacaggtgcatcctgatgacgtggagaagctgagagagcaactgtgc
acctcagaaaactcaatgacaggccggatcttggacctgaagactgggacggtcaagaaa
gaagggcagcagtcatccatgaggatgtgcatgggctcgcggcggtctttcatctgcagg
atgaggtgtggaaatgctcctttggaccaccttcctctaaacagaataaccaccatgagg
aaaaggttcaggaatggccttggccctgtgaaagaaggagaagcccaatatgctgtggtc
cactgtacaggatacatcaaggcctggccaccagcaggaatgaccatacctgaagaagac
gctgatgtgggacaaggcagtaaatattgcctcgtggcaattgggagactccaggtgacc
agctctcctgtatgcatggacatgaatgggatgtcggtgcccacagagttcttatcccgg
cataactccgatggaatcatcacatttgtggatccaagatgtatcagtgtgattggctac
caaccccaggatcttctgggaaaggacattttggaattctgccaccctgaggatcaaagc
catctgcgtgagagcttccagcaggtggttaagctgaaaggccaagtcctgtcggtcatg
tatcgatttcgcaccaagaaccgggagtggatgttgatccgcaccagcagcttcacattc
cagaatccctattctgatgagattgagtacatcatctgcaccaacaccaacgtcaagcaa
cttcagcaacagcaggcagaattggaagtgcaccagagagatggattgtcatcgtatgac
ttatcccaggtccccgtccccaacctaccagccggtgttcatgaggccgggaagtccgtg
gaaaaggcggatgcaatcttctcccaggaaagagatcctcggtttgctgaaatgtttgca
ggaattagtgcatcggagaagaagatgatgagctcagcctctgcagcaggaacccagcag
atctactcccaaggaagcccatttccctctggacactccgggaaggccttcagctcttca
gtggttcatgtgcctggagtgaatgatattcagtcctcttcttccacgggccagaacatg
tcccaaatctcccggcagctaaaccagagtcaggtggcatggacagggagtcgtccgccc
tttccgggacagcaaatcccatctcagtccagcaagactcagtcatctccctttgggatt
ggaacgagccacacctacccggcagacccctcttcctacagccccctctccagcccagct
acctcctcgccaagtgggaatgcctactccagtcttgccaacaggactccagggttcgct
gaaagtggacaaagtagcgggcagttccaagggcggccctcggaagtctggtcgcagtgg
caaagccagcaccatggccagcagagcggtgagcagcactcccaccagcagcccggtcag
actgaagtgttccaggacatgctgcccatgccaggagatccaacccaggggactggcaac
tataacatcgaagactttgccgacctgggcatgtttccaccgttttctgagtag

DBGET integrated database retrieval system