KEGG   Homo sapiens (human): 4116
Entry
4116              CDS       T01001                                 

Symbol
MAGOH, MAGOH1, MAGOHA
Name
(RefSeq) mago homolog, exon junction complex subunit
  KO
K12877  protein mago nashi
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4116 (MAGOH)
  09122 Translation
   03013 Nucleocytoplasmic transport
    4116 (MAGOH)
   03015 mRNA surveillance pathway
    4116 (MAGOH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4116 (MAGOH)
   03041 Spliceosome [BR:hsa03041]
    4116 (MAGOH)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4116 (MAGOH)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    4116 (MAGOH)
SSDB
Motif
Pfam: Mago_nashi
Other DBs
NCBI-GeneID: 4116
NCBI-ProteinID: NP_002361
OMIM: 602603
HGNC: 6815
Ensembl: ENSG00000162385
Vega: OTTHUMG00000008932
Pharos: P61326(Tbio)
UniProt: P61326
LinkDB
Structure
PDB: 

Position
1p32.3
AA seq 146 aa
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEEL
KRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR
VFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 441 nt   +upstreamnt  +downstreamnt
atggagagtgacttttatctgcgttactacgtggggcacaagggcaagttcggccacgag
ttcctggagtttgagtttcgaccggacgggaagttaagatatgccaacaacagcaattac
aagaatgatgtcatgatcagaaaagaggcttatgtacataaaagcgtgatggaggaactg
aagagaataattgacgacagtgaaattaccaaagaggatgatgcattgtggcctcctcct
gaccgagtgggccggcaggagcttgaaatcgtcattggagatgaacacatttcttttaca
acatcaaaaattggttcccttattgatgtcaatcaatccaaggatccagaaggcttacga
gtattttattatcttgtccaggacctgaagtgtttggtcttcagtcttattggattacac
ttcaagattaaaccaatctag

KEGG   Homo sapiens (human): 55110
Entry
55110             CDS       T01001                                 

Symbol
MAGOHB, MGN2, mago, magoh
Name
(RefSeq) mago homolog B, exon junction complex subunit
  KO
K12877  protein mago nashi
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    55110 (MAGOHB)
  09122 Translation
   03013 Nucleocytoplasmic transport
    55110 (MAGOHB)
   03015 mRNA surveillance pathway
    55110 (MAGOHB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    55110 (MAGOHB)
   03041 Spliceosome [BR:hsa03041]
    55110 (MAGOHB)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     55110 (MAGOHB)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    55110 (MAGOHB)
SSDB
Motif
Pfam: Mago_nashi
Other DBs
NCBI-GeneID: 55110
NCBI-ProteinID: NP_060518
HGNC: 25504
Ensembl: ENSG00000111196
Vega: OTTHUMG00000168407
Pharos: Q96A72(Tdark)
UniProt: Q96A72 A0A023T6R1
LinkDB
Structure
PDB: 
6ICZ

Position
12p13.2
AA seq 148 aa
MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVME
ELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEG
LRVFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 447 nt   +upstreamnt  +downstreamnt
atggctgtggctagcgatttctacctgcgctactacgtagggcacaagggcaagtttggg
cacgagtttctggagttcgaatttcggccggacggaaagcttagatatgccaacaacagc
aattacaaaaatgatgtcatgatcagaaaagaggcttatgtgcacaagagtgtaatggaa
gaactgaagagaattattgatgacagtgaaattacaaaagaagatgatgctttgtggcct
ccccctgatagggttggccgacaggagcttgaaattgtaattggagatgagcacatatct
tttaccacatcaaaaataggttctcttattgatgtaaatcagtcaaaggatcctgaaggc
cttcgagtattttactatttggtacaagacttgaaatgtttagttttcagtcttattgga
ttacacttcaagattaaaccaatttaa

DBGET integrated database retrieval system