KEGG   Homo sapiens (human): 414062
Entry
414062            CDS       T01001                                 
Symbol
CCL3L3, 464.2, D17S1718, G0S19-2, LD78, LD78BETA, SCYA3L, SCYA3L1
Name
(RefSeq) C-C motif chemokine ligand 3 like 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    414062 (CCL3L3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    414062 (CCL3L3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    414062 (CCL3L3)
   04062 Chemokine signaling pathway
    414062 (CCL3L3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    414062 (CCL3L3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    414062 (CCL3L3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    414062 (CCL3L3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    414062 (CCL3L3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    414062 (CCL3L3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    414062 (CCL3L3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   414062 (CCL3L3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   414062 (CCL3L3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 414062
NCBI-ProteinID: NP_001001437
OMIM: 609468
HGNC: 30554
Ensembl: ENSG00000276085
UniProt: P16619
LinkDB
Position
17:complement(36194869..36196758)
AA seq 93 aa
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6348
Entry
6348              CDS       T01001                                 
Symbol
CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
Name
(RefSeq) C-C motif chemokine ligand 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01167  VAV vCCI to CCR signaling
N01168  CCL3/7 to HCMV US28 signaling
N01169  CCL3 to HHV6 U12 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Disease
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6348 (CCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6348 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6348 (CCL3)
   04062 Chemokine signaling pathway
    6348 (CCL3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6348 (CCL3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6348 (CCL3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6348 (CCL3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6348 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6348 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6348 (CCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6348 (CCL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6348 (CCL3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6348
NCBI-ProteinID: NP_002974
OMIM: 182283
HGNC: 10627
Ensembl: ENSG00000277632
Pharos: P10147(Tbio)
UniProt: P10147 A0N0R1
Structure
LinkDB
Position
17:complement(36088256..36090143)
AA seq 92 aa
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag
ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacacctcccgg
cagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaagccc
ggtgtcatcttcctaaccaagcgaagccggcaggtctgtgctgaccccagtgaggagtgg
gtccagaaatatgtcagcgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6349
Entry
6349              CDS       T01001                                 
Symbol
CCL3L1, 464.2, D17S1718, G0S19-2, LD78, LD78-beta(1-70), LD78BETA, MIP1AP, SCYA3L, SCYA3L1
Name
(RefSeq) C-C motif chemokine ligand 3 like 1
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Disease
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6349 (CCL3L1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6349 (CCL3L1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6349 (CCL3L1)
   04062 Chemokine signaling pathway
    6349 (CCL3L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6349 (CCL3L1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6349 (CCL3L1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6349 (CCL3L1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6349 (CCL3L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6349 (CCL3L1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6349 (CCL3L1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6349 (CCL3L1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6349 (CCL3L1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6349
NCBI-ProteinID: NP_066286
OMIM: 601395
HGNC: 10628
Pharos: P16619(Tbio)
UniProt: P16619
LinkDB
Position
17q21.1
AA seq 93 aa
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

KEGG   Homo sapiens (human): 6352
Entry
6352              CDS       T01001                                 
Symbol
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
Name
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
hsa05020  Prion disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00429  HCMV UL22A to CCR5-GNB/G-PLCB/G-PKC signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01182  VAV vCCI to CCR signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
N01184  CCL5 to HHV6 U12 signaling
N01185  CCL5/11 to HHV6 U51 signaling
N01190  CCL5/17/22 to CCR4 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6352 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6352 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6352 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6352 (CCL5)
   04621 NOD-like receptor signaling pathway
    6352 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    6352 (CCL5)
   04062 Chemokine signaling pathway
    6352 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    6352 (CCL5)
   05168 Herpes simplex virus 1 infection
    6352 (CCL5)
   05163 Human cytomegalovirus infection
    6352 (CCL5)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6352 (CCL5)
   05131 Shigellosis
    6352 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6352 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6352 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    6352 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6352 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6352 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6352 (CCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6352 (CCL5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6352 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6352
NCBI-ProteinID: NP_002976
OMIM: 187011
HGNC: 10632
Ensembl: ENSG00000271503
Pharos: P13501(Tchem)
UniProt: P13501 D0EI67
Structure
LinkDB
Position
17:complement(35871491..35880360)
AA seq 91 aa
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctag

KEGG   Homo sapiens (human): 6354
Entry
6354              CDS       T01001                                 
Symbol
CCL7, FIC, MARC, MCP-3, MCP3, NC28, SCYA6, SCYA7
Name
(RefSeq) C-C motif chemokine ligand 7
  KO
K05509  C-C motif chemokine 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01167  VAV vCCI to CCR signaling
N01168  CCL3/7 to HCMV US28 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6354 (CCL7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6354 (CCL7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6354 (CCL7)
   04062 Chemokine signaling pathway
    6354 (CCL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6354 (CCL7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6354 (CCL7)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6354
NCBI-ProteinID: NP_006264
OMIM: 158106
HGNC: 10634
Ensembl: ENSG00000108688
Pharos: P80098(Tbio)
UniProt: P80098
Structure
LinkDB
Position
17:34270221..34272242
AA seq 99 aa
MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaagcctctgcagcacttctgtgtctgctgctcacagcagctgctttcagcccccag
gggcttgctcagccagttgggattaatacttcaactacctgctgctacagatttatcaat
aagaaaatccctaagcagaggctggagagctacagaaggaccaccagtagccactgtccc
cgggaagctgtaatcttcaagaccaaactggacaaggagatctgtgctgaccccacacag
aagtgggtccaggactttatgaagcacctggacaagaaaacccaaactccaaagctttga

KEGG   Homo sapiens (human): 6355
Entry
6355              CDS       T01001                                 
Symbol
CCL8, HC14, MCP-2, MCP2, SCYA10, SCYA8
Name
(RefSeq) C-C motif chemokine ligand 8
  KO
K16596  C-C motif chemokine 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6355 (CCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6355 (CCL8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6355 (CCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6355 (CCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6355 (CCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6355
NCBI-ProteinID: NP_005614
OMIM: 602283
HGNC: 10635
Ensembl: ENSG00000108700
Pharos: P80075(Tbio)
UniProt: P80075
Structure
LinkDB
Position
17:34319435..34321402
AA seq 99 aa
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtttctgcagcgcttctgtgcctgctgctcatggcagccactttcagccctcag
ggacttgctcagccagattcagtttccattccaatcacctgctgctttaacgtgatcaat
aggaaaattcctatccagaggctggagagctacacaagaatcaccaacatccaatgtccc
aaggaagctgtgatcttcaagaccaaacggggcaaggaggtctgtgctgaccccaaggag
agatgggtcagggattccatgaagcatctggaccaaatatttcaaaatctgaagccatga

KEGG   Homo sapiens (human): 6357
Entry
6357              CDS       T01001                                 
Symbol
CCL13, CKb10, MCP-4, NCC-1, NCC1, SCYA13, SCYL1
Name
(RefSeq) C-C motif chemokine ligand 13
  KO
K16595  C-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01182  VAV vCCI to CCR signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6357 (CCL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6357 (CCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6357 (CCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6357 (CCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6357 (CCL13)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6357 (CCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6357 (CCL13)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6357 (CCL13)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6357
NCBI-ProteinID: NP_005399
OMIM: 601391
HGNC: 10611
Ensembl: ENSG00000181374
Pharos: Q99616(Tbio)
UniProt: Q99616
Structure
LinkDB
Position
17:34356480..34358610
AA seq 98 aa
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ
KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaagtctctgcagtgcttctgtgcctgctgctcatgacagcagctttcaacccccag
ggacttgctcagccagatgcactcaacgtcccatctacttgctgcttcacatttagcagt
aagaagatctccttgcagaggctgaagagctatgtgatcaccaccagcaggtgtccccag
aaggctgtcatcttcagaaccaaactgggcaaggagatctgtgctgacccaaaggagaag
tgggtccagaattatatgaaacacctgggccggaaagctcacaccctgaagacttga

KEGG   Homo sapiens (human): 6358
Entry
6358              CDS       T01001                                 
Symbol
CCL14, CC-1, CC-3, CKB1, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14
Name
(RefSeq) C-C motif chemokine ligand 14
  KO
K21092  C-C motif chemokine 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6358 (CCL14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6358 (CCL14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6358 (CCL14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6358 (CCL14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6358 (CCL14)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6358
NCBI-ProteinID: NP_116739
OMIM: 601392
HGNC: 10612
Ensembl: ENSG00000276409
Pharos: Q16627(Tbio)
UniProt: Q16627
Structure
LinkDB
Position
17:complement(35983288..35986729)
AA seq 93 aa
MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCS
KPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagatctccgtggctgccattcccttcttcctcctcatcaccatcgccctagggacc
aagactgaatcctcctcacggggaccttaccacccctcagagtgctgcttcacctacact
acctacaagatcccgcgtcagcggattatggattactatgagaccaacagccagtgctcc
aagcccggaattgtcttcatcaccaaaaggggccattccgtctgtaccaaccccagtgac
aagtgggtccaggactatatcaaggacatgaaggagaactga

KEGG   Homo sapiens (human): 6359
Entry
6359              CDS       T01001                                 
Symbol
CCL15, HCC-2, HMRP-2B, LKN-1, LKN1, MIP-1_delta, MIP-1D, MIP-5, MRP-2B, NCC-3, NCC3, SCYA15, SCYL3, SY15
Name
(RefSeq) C-C motif chemokine ligand 15
  KO
K05511  C-C motif chemokine 15/23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6359 (CCL15)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6359 (CCL15)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6359 (CCL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6359 (CCL15)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6359 (CCL15)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6359
NCBI-ProteinID: NP_116741
OMIM: 601393
HGNC: 10613
Ensembl: ENSG00000275718
Pharos: Q16663(Tbio)
UniProt: Q16663 A0A0B4J2E2
Structure
LinkDB
Position
17:complement(35997582..36001553)
AA seq 113 aa
MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQ
SIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctcctgcctcatgcttgttgctgtccttggatcccag
gcccagttcacaaatgatgcagagacagagttaatgatgtcaaagcttccactggaaaat
ccagtagttctgaacagctttcactttgctgctgactgctgcacctcctacatctcacaa
agcatcccgtgttcactcatgaaaagttattttgaaacgagcagcgagtgctccaagcca
ggtgtcatattcctcaccaagaaggggcggcaagtctgtgccaaacccagtggtccggga
gttcaggattgcatgaaaaagctgaagccctactcaatataa

KEGG   Homo sapiens (human): 6360
Entry
6360              CDS       T01001                                 
Symbol
CCL16, CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4
Name
(RefSeq) C-C motif chemokine ligand 16
  KO
K21093  C-C motif chemokine 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6360 (CCL16)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6360 (CCL16)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6360 (CCL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6360 (CCL16)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6360 (CCL16)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6360
NCBI-ProteinID: NP_004581
OMIM: 601394
HGNC: 10614
Ensembl: ENSG00000275152
Pharos: O15467(Tbio)
UniProt: O15467
Structure
LinkDB
Position
17:complement(35976499..35981497)
AA seq 120 aa
MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNC
HLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaggtctccgaggctgccctgtctctccttgtcctcatccttatcattacttcggct
tctcgcagccagccaaaagttcctgagtgggtgaacaccccatccacctgctgcctgaag
tattatgagaaagtgttgccaaggagactagtggtgggatacagaaaggccctcaactgt
cacctgccagcaatcatcttcgtcaccaagaggaaccgagaagtctgcaccaaccccaat
gacgactgggtccaagagtacatcaaggatcccaacctacctttgctgcctaccaggaac
ttgtccacggttaaaattattacagcaaagaatggtcaaccccagctcctcaactcccag
tga

DBGET integrated database retrieval system