KEGG   Homo sapiens (human): 4267
Entry
4267              CDS       T01001                                 
Symbol
CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X
Name
(RefSeq) CD99 molecule (Xg blood group)
  KO
K06520  CD99 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    4267 (CD99)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    4267 (CD99)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    4267 (CD99)
CD molecules [BR:hsa04090]
 Proteins
  4267 (CD99)
SSDB
Motif
Pfam: CD99L2
Other DBs
NCBI-GeneID: 4267
NCBI-ProteinID: NP_002405
OMIM: 313470 450000
HGNC: 7082
Ensembl: ENSG00000002586
Vega: OTTHUMG00000021073
Pharos: P14209(Tbio)
UniProt: P14209
LinkDB
Position
X:2691295..2741309, Y:2691295..2741309
AA seq 185 aa
MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVV
DGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEE
ADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQR
TLLEK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggcccgcggggctgcgctggcgctgctgctcttcggcctgctgggtgttctggtcgcc
gccccggatggtggtttcgatttatccgatgcccttcctgacaatgaaaacaagaaaccc
actgcaatccccaagaaacccagtgctggggatgactttgacttaggagatgctgttgtt
gatggagaaaatgacgacccacgaccaccgaacccacccaaaccgatgccaaatccaaac
cccaaccaccctagttcctccggtagcttttcagatgctgaccttgcggatggcgtttca
ggtggagaaggaaaaggaggcagtgatggtggaggcagccacaggaaagaaggggaagag
gccgacgccccaggcgtgatccccgggattgtgggggctgtcgtggtcgccgtggctgga
gccatctctagcttcattgcttaccagaaaaagaagctatgcttcaaagaaaatgcagaa
caaggggaggtggacatggagagccaccggaatgccaacgcagagccagctgttcagcgt
actcttttagagaaatag

KEGG   Homo sapiens (human): 83692
Entry
83692             CDS       T01001                                 
Symbol
CD99L2, CD99B, MIC2L1
Name
(RefSeq) CD99 molecule like 2
  KO
K06520  CD99 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    83692 (CD99L2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    83692 (CD99L2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    83692 (CD99L2)
CD molecules [BR:hsa04090]
 Proteins
  83692 (CD99L2)
SSDB
Motif
Pfam: CD99L2 ACT_7
Other DBs
NCBI-GeneID: 83692
NCBI-ProteinID: NP_113650
OMIM: 300846
HGNC: 18237
Ensembl: ENSG00000102181
Vega: OTTHUMG00000024247
Pharos: Q8TCZ2(Tdark)
UniProt: Q8TCZ2 A0A024RC16
LinkDB
Position
X:complement(150766336..150898668)
AA seq 262 aa
MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTT
RAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFD
LADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGM
VAEPGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQ
VKYSTLHTQSAEPPPPPEPARI
NT seq 789 nt   +upstreamnt  +downstreamnt
atggtggcctggcgctcggcgttccttgtctgcctcgctttctccttggccaccctggtc
cagcgaggatctggggactttgatgattttaacctggaggatgcagtgaaagaaacttcc
tcagtaaagcagccatgggaccacaccaccaccaccacaaccaataggccaggaaccacc
agagctccggcaaaacctccaggtagtggattggacttggctgatgctttggatgatcaa
gatgatggccgcaggaaaccgggtataggaggaagagagagatggaaccatgtaaccacc
acgaccaagaggccagtaaccaccagagctccagcaaatactttaggaaatgattttgac
ttggctgatgccctggatgatcgaaatgatcgagatgatggccgcaggaaaccaattgct
ggaggaggaggtttttcagacaaggatcttgaagacatagtagggggtggagaatacaaa
cctgacaagggtaaaggtgatggccggtacggcagcaatgacgaccctggatctggcatg
gtggcagagcctggcaccattgccggggtggccagcgccctggccatggccctcatcggt
gccgtctccagctacatctcctaccagcagaagaagttctgcttcagcattcagcagggt
ctcaacgcagactacgtgaagggagagaacctggaagccgtggtatgtgaggaaccccaa
gtgaaatactccacgttgcacacgcagtctgcagagccgccgccgccgcccgaaccagcc
cggatctga

DBGET integrated database retrieval system