KEGG   Homo sapiens (human): 4534
Entry
4534              CDS       T01001                                 
Symbol
MTM1, CNM, CNMX, MTMX, XLMTM
Name
(RefSeq) myotubularin 1
  KO
K01108  myotubularin [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Disease
H00700  Centronuclear myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4534 (MTM1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4534 (MTM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    4534 (MTM1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     4534 (MTM1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     4534 (MTM1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    4534 (MTM1)
SSDB
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase 3-PAP Y_phosphatase3
Other DBs
NCBI-GeneID: 4534
NCBI-ProteinID: NP_000243
OMIM: 300415
HGNC: 7448
Ensembl: ENSG00000171100
Pharos: Q13496(Tbio)
UniProt: Q13496 A0A024RC06
LinkDB
Position
X:150562653..150673143
AA seq 603 aa
MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSSLILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRNLR
FALKQEGHSRRDMFEILTRYAFPLAHSLPLFAFLNEEKFNVDGWTVYNPVEEYRRQGLPN
HHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIV
RCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANKATGGGYESDDA
YHNAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLVLTGAIQV
ADKVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFAS
RIGHGDKNHTDADRSPIFLQFIDCVWQMSKQFPTAFEFNEQFLIIILDHLYSCRFGTFLF
NCESARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQ
THF
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggcttctgcatcaacttctaaatataattcacactccttggagaatgagtctattaag
aggacgtctcgagatggagtcaatcgagatctcactgaggctgttcctcgacttccagga
gaaacactaatcactgacaaagaagttatttacatatgtcctttcaatggccccattaag
ggaagagtttacatcacaaattatcgtctttatttaagaagtttggaaacggattcttct
ctaatacttgatgttcctctgggtgtgatctcgagaattgaaaaaatgggaggcgcgaca
agtagaggagaaaattcctatggtctagatattacttgtaaagacatgagaaacctgagg
ttcgctttgaaacaggaaggccacagcagaagagatatgtttgagatcctcacgagatac
gcgtttcccctggctcacagtctgccattatttgcatttttaaatgaagaaaagtttaac
gtggatggatggacagtttacaatccagtggaagaatacaggaggcagggcttgcccaat
caccattggagaataacttttattaataagtgctatgagctctgtgacacttaccctgct
cttttggtggttccgtatcgtgcctcagatgatgacctccggagagttgcaacttttagg
tcccgaaatcgaattccagtgctgtcatggattcatccagaaaataagacggtcattgtg
cgttgcagtcagcctcttgtcggtatgagtgggaaacgaaataaagatgatgagaaatat
ctcgatgttatcagggagactaataaacaaatttctaaactcaccatttatgatgcaaga
cccagcgtaaatgcagtggccaacaaggcaacaggaggaggatatgaaagtgatgatgca
tatcataacgccgaacttttcttcttagacattcataatattcatgttatgcgggaatct
ttaaaaaaagtgaaggacattgtttatcctaatgtagaagaatctcattggttgtccagt
ttggagtctactcattggttagaacatatcaagctcgttttgacaggagccattcaagta
gcagacaaagtttcttcagggaagagttcagtgcttgtgcattgcagtgacggatgggac
aggactgctcagctgacatccttggccatgctgatgttggatagcttctataggagcatt
gaagggttcgaaatactggtacaaaaagaatggataagttttggacataaatttgcatct
cgaataggtcatggtgataaaaaccacaccgatgctgaccgttctcctatttttctccag
tttattgattgtgtgtggcaaatgtcaaaacagttccctacagcttttgaattcaatgaa
caatttttgattataattttggatcatctgtatagttgccgatttggtactttcttattc
aactgtgaatctgctcgagaaagacagaaggttacagaaaggactgtttctttatggtca
ctgataaacagtaataaagaaaaattcaaaaaccccttctatactaaagaaatcaatcga
gttttatatccagttgccagtatgcgtcacttggaactctgggtgaattactacattaga
tggaaccccaggatcaagcaacaacagccgaatccagtggagcagcgttacatggagctc
ttagccttacgcgacgaatacataaagcggcttgaggaactgcagctcgccaactctgcc
aagctttctgatcccccaacttcaccttccagtccttcgcaaatgatgccccatgtgcaa
actcacttctga

KEGG   Homo sapiens (human): 55613
Entry
55613             CDS       T01001                                 
Symbol
MTMR8
Name
(RefSeq) myotubularin related protein 8
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    55613 (MTMR8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    55613 (MTMR8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    55613 (MTMR8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     55613 (MTMR8)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     55613 (MTMR8)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    55613 (MTMR8)
SSDB
Motif
Pfam: Myotub-related Vps36_ESCRT-II Y_phosphatase DSPc
Other DBs
NCBI-GeneID: 55613
NCBI-ProteinID: NP_060147
OMIM: 301061
HGNC: 16825
Ensembl: ENSG00000102043
Pharos: Q96EF0(Tdark)
UniProt: Q96EF0
Structure
LinkDB
Position
X:complement(64268081..64395452)
AA seq 704 aa
MDHITVPKVENVKLVDRYVSKKPANGILYLTATHLIYVEASGAARKETWIALHHIATVEK
LPITSLGCPLTLRCKNFRVAHFVLDSDLVCHEVYISLLKLSQPALPEDLYAFSYNPKSSK
EMRESGWKLIDPISDFGRMGIPNRNWTITDANRNYEICSTYPPEIVVPKSVTLGTVVGSS
KFRSKERVPVLSYLYKENNAAICRCSQPLSGFYTRCVDDELLLEAISQTNPGSQFMYVVD
TRPKLNAMANRAAGKGYENEDNYANIRFRFMGIENIHVMRSSLQKLLEVCELKTPTMSEF
LSGLESSGWLRHIKAIMDAGIFITKAVKVEKASVLVHCSDGWDRTAQVCSVASILLDPFY
RTFKGLMILIEKEWISMGHKFSQRCGHLDGDSKEVSPIFTQFLDCIWQLMEQFPCAFEFN
ENFLLEIHDHVFSCQFGNFLGNCQKDREDLRVYEKTHSVWPFLVQRKPDFRNPLYKGFTM
YGVLNPSTVPYNIQFWCGMYNRFDKGLQPKQSMLESLLEIKKQRAMLETDVHELEKKLKV
RDEPPEEICTCSQLGNILSQHLGSPLTNPLGFMGINGDLNTLMENGTLSREGGLRAQMDQ
VKSQGADLHHNCCEIVGSLRAINISGDVGISEAMGISGDMCTFEATGFSKDLGICGAMDI
SEATGISGNLGISEARGFSGDMGILGDTGISKASTKEADYSKHQ
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggatcatattacggtacccaaggtagaaaacgtgaaattggtggatcgttatgtgagt
aagaaaccagctaatgggattctttatcttactgcaacccacctgatctatgtggaggct
tcaggtgcagcccggaaagaaacatggattgcactccatcacattgccactgtggagaag
ttacccatcactagcctgggttgtcccctgaccctccgctgcaagaatttccgggtggcc
cactttgttttagattctgaccttgtgtgccatgaggtttatatttcactgctcaagctt
tctcagccagcattacctgaagatctttatgctttttcttataatcccaaatcctcaaaa
gagatgagggaaagtggatggaaactgattgacccaatatcagactttgggcgtatggga
atacccaacagaaactggaccataacagatgccaacagaaactatgagatatgcagcacc
taccctcctgaaatagtggttcctaaatctgttaccttgggaacggtggttggaagttca
aagttcagaagtaaagaacgtgtccctgtgctctcctacctctacaaagagaacaatgct
gccatttgccgctgtagccagcctctctctggattttacactcgctgtgtagatgatgag
ctcttgttggaggccattagccaaacaaacccagggagccagtttatgtatgttgtagac
acaagaccaaagttgaatgccatggccaaccgagcagctgggaaggggtatgaaaatgaa
gacaactatgccaacattcgcttcagattcatgggcattgagaacatccatgtaatgcgg
agcagtctgcagaaactcttggaagtttgtgaattgaaaactccaacaatgagtgaattt
cttagcggcctggagagctcagggtggttaagacacattaaagctattatggatgctgga
attttcattacaaaggcagtgaaggtagaaaaggccagtgtcttagtccattgttctgat
ggatgggaccgcacagcacaagtctgctcagtggctagcatcctcctagatccattttat
aggacattcaaaggactcatgatcttgatagagaaggaatggatatccatgggccacaag
ttttcccaaaggtgtggccacctcgatggggactctaaagaagtgtcccctatcttcacc
cagttcctagactgtatctggcaattaatggaacagtttccctgtgcctttgagtttaat
gaaaacttcctgctggagattcatgaccatgttttctcctgccagtttggaaacttcctt
ggtaactgccagaaggatcgggaagatctaagagtctatgagaaaacacattctgtgtgg
cctttcttggttcagaggaaaccagacttcaggaaccctctctataaaggcttcactatg
tatggggtactcaatcctagtactgtgccctacaacattcagttctggtgtgggatgtat
aaccgctttgacaaagggctgcagcccaagcagagtatgctagagagcctcctggaaatt
aagaaacagagagcaatgctggagacagatgtgcatgaactagaaaagaaactaaaagtc
cgtgatgagccaccagaagagatctgtacctgctctcaattaggaaacatattatcccag
catctgggaagtcctttgaccaatcctcttggctttatgggtatcaatggagacctgaat
accctgatggagaatggcaccctatccagggaaggaggcctccgagctcagatggatcaa
gtaaaaagccagggtgcagacctccaccataactgttgtgagattgtgggcagccttagg
gccataaatatctctggggatgtgggcatctctgaggccatgggcatctctggagacatg
tgcacctttgaggctacgggcttctccaaagacttaggaatctgtggggccatggacatc
tctgaggccactggcatctctggaaacttgggtatttctgaggccaggggtttctctggg
gacatgggcatcttgggggacacaggcatctccaaggccagcaccaaggaggcagactac
tccaagcatcagtga

KEGG   Homo sapiens (human): 64419
Entry
64419             CDS       T01001                                 
Symbol
MTMR14, C3orf29
Name
(RefSeq) myotubularin related protein 14
  KO
K18086  myotubularin-related protein 14 [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    64419 (MTMR14)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    64419 (MTMR14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64419 (MTMR14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    64419 (MTMR14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     64419 (MTMR14)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     64419 (MTMR14)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    64419 (MTMR14)
SSDB
Motif
Pfam: Myotub-related Y_phosphatase3 Y_phosphatase
Other DBs
NCBI-GeneID: 64419
NCBI-ProteinID: NP_001070993
OMIM: 611089
HGNC: 26190
Ensembl: ENSG00000163719
Pharos: Q8NCE2(Tbio)
UniProt: Q8NCE2
LinkDB
Position
3:9649505..9702393
AA seq 650 aa
MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKR
CLELFGRDYCFSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRS
KMARCRGRFVCPVILFKGKHICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEE
DCALRSGDTHLFDKVRGYDIKLLRYLSVKYICDLMVENKKVKFGMNVTSSEKVDKAQRYA
DFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQC
WDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLKP
TEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD
GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWRK
SHSSSPQSVLWNRPQPSEDRLPSQQGLAEARSSSSSSSNHSDNFFRMGSSPLEVPKPRSV
DHPLPGSSLSTDYGSWQMVTGCGSIQERAVLHTDSSLPFSFPDELPNSCLLAALSDRETR
LQEVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRSISSNAL
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggccggcgctcgggccgccgccgccgctgcctcggcggggtcctcggcctcttcaggc
aaccagccgcctcaggagctggggcttggggagctgctggaggagttctcccggactcag
taccgggccaaggatggcagcgggaccggcggctctaaggttgagcgcattgagaagaga
tgtctggagctgtttggccgagactactgtttcagcgtgattccaaacacgaatggggat
atctgtggccactatccccggcacatcgtgttcctggagtatgagagttctgagaaggag
aaagacacgtttgagagtaccgtacaggtgagcaagttgcaagacctcatccaccgcagc
aagatggcccggtgcagaggacggtttgtctgcccagtaatcctgttcaagggcaagcac
atttgcaggtcggccacactggctggatggggagagctgtatggacgctcaggctacaac
tattttttctcagggggtgcagatgatgcctgggcagatgtggaggacgtcacggaggag
gactgtgctcttcgaagtggtgacacgcatctttttgataaggtcagaggctatgacatc
aagctgcttcgatacctgtcagtcaaatacatctgtgacctgatggtggagaacaagaag
gtgaagtttggcatgaatgtaacctcctctgagaaggtggacaaagcccagcgctatgcc
gacttcactctcctctccatcccgtatccaggctgtgaatttttcaaggaatataaagat
cgggattacatggcagaagggctcatatttaactggaagcaggactacgttgatgcccca
ttgagcatccccgacttcctgactcactctctgaacattgactggagccagtatcagtgt
tgggatctggtgcaacaaacacaaaactacctgaagctgctgctttccttagttaacagt
gatgatgacagcgggctgctggtacactgtatctcaggctgggatcggacccccctcttc
atctccctcctgcgcctttccttgtgggctgatgggctcatccacacgtccctgaagccc
actgagatcctctacctcactgtggcctatgactggttcctcttcgggcacatgttggta
gatcggctcagcaaaggggaggagattttcttcttctgcttcaattttttgaagcatatt
acctccgaggagttctctgctctgaagacccagaggaggaagagtttgccagcccgggat
ggaggcttcaccctggaagacatctgcatgctgagacgaaaggaccgtggcagcaccacc
agccttggcagcgacttctccctggtcatggagagttccccaggagccactgggagcttc
acctatgaggccgtggagctggtcccagcaggagcgccaactcaggcagcttggaggaag
agccactcatcctctccacagagtgtcctctggaaccggccacaaccctcagaggaccgc
ttgccttcccagcaggggctggcggaagccaggtcttccagctcctcttcctcaaaccat
tctgataactttttcaggatgggtagcagtcccctggaggtccccaaacccagatcagtg
gaccatcccctgcccggatcctctctctccacagactatggcagctggcagatggtaacg
ggctgtggcagtattcaggagcgggctgtcctgcacacagactcctctctccctttcagc
ttcccggatgagctccctaacagttgtctgcttgcagccctgagtgatcgagagactcgg
ctgcaggaggtgcgctcagccttcttggctgcgtacagcagcacagtggggcttcgggca
gtagcccccagtccttccggtgccatcgggggcctgctggagcaatttgcccgtggtgtt
ggactccggagcatcagcagcaatgccttgtga

KEGG   Homo sapiens (human): 8776
Entry
8776              CDS       T01001                                 
Symbol
MTMR1
Name
(RefSeq) myotubularin related protein 1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8776 (MTMR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8776 (MTMR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8776 (MTMR1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     8776 (MTMR1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     8776 (MTMR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    8776 (MTMR1)
SSDB
Motif
Pfam: Myotub-related GRAM Y_phosphatase DSPc Myb_CC_LHEQLE Y_phosphatase3 3-PAP
Other DBs
NCBI-GeneID: 8776
NCBI-ProteinID: NP_003819
OMIM: 300171
HGNC: 7449
Ensembl: ENSG00000063601
Pharos: Q13613(Tbio)
UniProt: Q13613 Q8NEC6
Structure
LinkDB
Position
X:150692962..150765108
AA seq 665 aa
MDRPAAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQ
LIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKDVMYICPFM
GAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMR
NLRLAYKQEEQSKLGIFENLNKHAFPLSNGQALFAFSYKEKFPINGWKVYDPVSEYKRQG
LPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLSKVAAFRAKGRVPVLSWIHPESQA
TITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGYES
ESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLEYIRMLLAGA
VRIADKIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFETLVEKEWISFGHR
FALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLYSCLFGT
FLCNCEQQRFKEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY
YVRWNPRMRPQMPIHQNLKELLAVRAELQKRVEGLQREVATRAVSSSSERGSSPSHSATS
VHTSV
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggacaggccggcggcggcggcggcggcgggctgcgagggcggcgggggcccgaacccg
gggccggcgggcggcaggaggcctcctcgggccgcggggggcgccaccgccggctcccgg
cagcccagcgtggagaccctggacagtcccacaggatcacatgttgaatggtgtaaacag
cttatagctgctacaatttctagtcagatttcaggttcagtgacatcagaaaatgtgtcc
agagattacaaggctctaagggatggaaataagctggcacagatggaagaggctccactt
ttcccaggagaatcaattaaagccattgtgaaagatgtcatgtatatctgcccatttatg
ggagcagtgagtggaaccctgacagtgacggactttaagctgtacttcaaaaatgtcgag
agggacccgcattttatccttgatgttccccttggagtgatcagcagagtggagaagatt
ggagcacagagccatggagacaattcctgtggtatagagatagtgtgcaaggatatgagg
aacttgcggcttgcttataaacaggaagaacagagtaaactagggatatttgaaaacctc
aacaaacatgcatttcctctttctaacggacaggcactatttgcattcagctataaagaa
aaatttccaattaatggctggaaagtttatgatccagtatctgaatataagagacagggc
ttgccaaatgagagttggaaaatatccaaaataaacagtaattatgagttctgtgacacc
taccctgccatcattgttgtgccaactagtgtaaaagatgatgacctttcaaaagtggca
gcttttcgagcaaaaggcagagtccctgtgttgtcatggattcatccggaaagtcaagca
acgattacccgttgcagccagccacttgtgggtcccaatgataagcgctgcaaagaggat
gaaaaatacttgcaaacaataatggatgctaacgcacagtcacacaagcttatcatcttt
gatgctcgacaaaacagtgtcgctgataccaacaagacaaagggtggaggatatgaaagt
gaaagtgcttacccaaatgcagaacttgtgttcttggagatccacaacattcatgtcatg
cgagagtcactacgcaaattaaaagagattgtgtacccttcgatcgatgaggcgcggtgg
ctctccaatgtggatgggacgcattggctggaatatataaggatgctgcttgctggggca
gtaagaattgctgataaaatagaatctgggaaaacatctgtggtggtgcattgcagcgac
ggttgggaccgaacagcccagctcacatctctggctatgctaatgttggacagttactac
aggaccattaaaggatttgaaactctcgtagaaaaggagtggataagctttggacacagg
tttgcactgcgagtgggccatggtaatgacaaccatgcggatgctgaccgatctcccata
tttctgcagtttgttgattgtgtttggcaaatgacaaggcagtttccttcagcattcgag
tttaatgagctattcttgattacaattttggatcacctttatagctgtctttttgggacc
tttttgtgcaactgtgaacagcagcgattcaaagaggatgtatatacaaagacgatatct
ttatggtcgtatatcaatagccagctagacgagttttctaatcccttctttgtgaattat
gaaaaccacgtgttatatcctgttgctagtctgagtcatttggaattgtgggtaaattat
tatgtacgatggaatccacggatgagacctcagatgcccattcaccagaatctcaaggag
ctgctggccgtcagggcggagctgcagaagcgtgtggagggcctacagcgggaggtggcc
acgcgcgccgtctcatcctcatctgagcggggctcctcgccctcccactccgccacctcc
gtccacacctcggtctga

KEGG   Homo sapiens (human): 8897
Entry
8897              CDS       T01001                                 
Symbol
MTMR3, FYVE-DSP1, ZFYVE10
Name
(RefSeq) myotubularin related protein 3
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8897 (MTMR3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8897 (MTMR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8897 (MTMR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8897 (MTMR3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     8897 (MTMR3)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     8897 (MTMR3)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     8897 (MTMR3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    8897 (MTMR3)
SSDB
Motif
Pfam: Myotub-related FYVE Y_phosphatase Y_phosphatase3 DSPc Csm1_N
Other DBs
NCBI-GeneID: 8897
NCBI-ProteinID: NP_066576
OMIM: 603558
HGNC: 7451
Ensembl: ENSG00000100330
Pharos: Q13615(Tbio)
UniProt: Q13615
LinkDB
Position
22:29883174..30030868
AA seq 1198 aa
MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEFVGRAEDAIIALSNYRL
HIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQEWLKRLNNAIRP
PAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISN
INEKYKLCGSYPQELIVPAWITDKELESVSSFRSWKRIPAVIYRHQSNGAVIARCGQPEV
SWWGWRNADDEHLVQSVAKACASDSRSSGSKLSTRNTSRDFPNGGDLSDVEFDSSLSNAS
GAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQ
SLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDQDQRPVLVHCSDGWDRT
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLL
RAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPTTPVDDSCAPYPAPGTSP
DDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDP
LSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKED
PLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQSGLSVLLSSLQ
VPPRGEDSLEVPVEQFRIEEIAEGREEAVLPIPVDAKVGYGTSQSCSLLPSQVPFETRGP
NVDSSTDMLVEDKVKSVSGPQGHHRSCLVNSGKDRLPQTMEPSPSETSLVERPQVGSVVH
RTSLGSTLSLTRSPCALPLAECKEGLVCNGAPETENRASEQPPGLSTLQMYPTPNGHCAN
GEAGRSKDSLSRQLSAMSCSSAHLHSRNLHHKWLHSHSGRPSATSSPDQPSRSHLDDDGM
SVYTDTIQQRLRQIESGHQQEVETLKKQVQELKSRLESQYLTSSLHFNGDFGDEVTSIPD
SESNLDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHCYACDSAFWLASRKHH
CRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIAATSN
NT seq 3597 nt   +upstreamnt  +downstreamnt
atggatgaagagactcggcacagccttgagtgcatccaggccaatcagatctttcccagg
aagcagctgatccgggaggatgagaatcttcaggttcctttccttgaacttcatggagag
agcacagagtttgtgggccgtgccgaggatgccatcattgccctttccaattacagactt
cacatcaagttcaaggagtctcttgttaatgttccattacagcttatagaaagtgttgaa
tgccgagatatatttcagcttcatttgacttgcaaagactgcaaagttatcaggtgtcag
ttttcaacctttgagcagtgtcaagagtggctgaagagactgaacaacgcaatccgacca
cctgctaaaatagaagatctcttctcatttgcataccatgcttggtgcatggaggtctat
gccagtgaaaaagagcaacatggagacctgtgcagaccaggggagcatgtaacttcaagg
tttaaaaacgaggtggagaggatgggttttgatatgaacaacgcctggaggatttccaac
atcaatgagaagtacaaattatgtggtagctatcctcaagagctcatagtgcctgcctgg
atcactgacaaagaactggaaagtgtatcaagtttcaggtcctggaagcgcatccctgcc
gtcatctacaggcaccagagcaatggagctgtcattgcccgctgtggacagccagaggtt
agctggtggggctggcgaaatgcagatgatgagcatctggtacagtcagtagccaaagct
tgtgcctctgactcccgatcgagtggcagcaagctgtcaactaggaacacttctcgagac
tttcccaatgggggagacctttctgacgtggagttcgattcttctctgtcaaatgcttca
ggagcagagagtttagccatccaaccgcagaagcttttgatcttggatgcacgctcctat
gcagctgctgtggcaaaccgagccaaaggaggaggctgcgaatgcccagagtattaccca
aactgtgaagttgtgtttatggggatggcaaacattcattctattcggaggagttttcag
tctctgcggttgctgtgcactcagatgccagatccgggaaattggctatcagctcttgaa
agcacaaaatggctccatcacttgtctgtgcttctgaaatcagcgcttctggtagtgcat
gctgtggatcaggatcagcggccggtgctagtacactgctcagatggctgggaccgcacc
ccccagattgtggcattggctaagctcttgctggacccttattaccgaaccatagagggt
ttccaggtcctcgtggaaatggagtggctggattttggccataaatttgctgaccggtgt
ggtcatggggagaactcggatgatctgaatgaacgttgcccagtgtttctgcagtggctt
gactgtgttcatcagcttcagaggcaatttccttgctcttttgagttcaatgaagcattc
cttgtgaaactggtgcagcatacctattcctgcctgtttggaacattcctgtgcaacaac
gccaaggagagaggggaaaagcatactcaggaacggacatgttccgtgtggtcacttctt
cgggcaggcaacaaggctttcaaaaacctactgtattcctctcagtcagaagccgtgctg
taccctgtgtgccatgtgcgtaacctgatgctgtggagtgcagtgtacctgccctgccca
tccccaaccacccctgtggacgacagctgtgcaccatacccagccccaggcaccagccct
gatgatccccccctgagccggctaccaaagactagatcatacgacaatctgaccacagcc
tgtgacaacacagtgcctctggccagccggcgctgcagcgaccccagcctgaacgagaag
tggcaggagcaccggcgctcactagagctgagcagcctggctggccctggagaggatccc
ctttctgccgacagcctagggaagcccaccagagtgccggggggtgccgagctttctgtt
gcagccggagtagctgaggggcagatggagaacatcttgcaggaggccaccaaagaggag
agtggagtagaggaacctgcccacagggcaggcattgagatacaggagggtaaagaggac
cctctcttagaaaaggagagcaggaggaagacacctgaggcctcagccattggacttcac
caagacccagaactgggtgatgctgctctgaggagccatctggatatgagctggcctctg
ttctcacagggcatttctgaacagcagagtgggctcagtgttctcctcagttctctccag
gtcccccccaggggagaggattccctggaggtccctgtggagcagtttcgaatagaagag
attgcagagggtagggaggaagcagttcttccaatcccagtagatgcaaaagttggctat
ggtacctcacagtcatgttctctgctaccttcccaagtcccttttgagaccagaggacca
aacgtggacagttctacagacatgttagtggaagataaggtgaagtcagtaagtgggccc
caaggtcatcatagatcttgccttgtaaatagtggcaaggacaggcttcctcagaccatg
gaacccagcccttcagagacaagcctggtcgagaggccccaagtggggtctgtggtgcat
aggacttcccttggcagcactctcagcctgacacgttccccttgtgccttgcctttagcc
gaatgtaaagaggggcttgtgtgcaatggtgccccagagactgaaaacagggcctcagag
cagcccccaggtcttagcaccctccagatgtaccccacacccaatgggcattgcgccaat
ggggaggctggtaggagcaaggactcactgagccgtcagctgtctgctatgagctgcagc
tctgcccacttacactcaaggaacttgcaccacaagtggctgcatagccactcaggaagg
ccatctgcaaccagcagccccgaccagccttcccgcagccacctggacgatgatggcatg
tcagtgtacacagacacgatccaacagcgcctgcgtcagattgagtcaggccaccagcag
gaagtagaaactttgaagaaacaagtccaggagctgaagagtcgcctggagagccagtac
ctgaccagctccctacactttaatggagactttggggatgaggtgacttcaatccccgac
tcggaaagcaatctggatcagaactgtttgtctcgctgcagcacagagattttctctgaa
gccagctgggagcaggtggataaacaggacacagagatgacccgttggcttcctgaccac
ctggccgcccactgctatgcgtgcgacagtgccttctggcttgccagcaggaagcaccac
tgcaggaattgtgggaacgtattctgctccagttgttgtaaccagaaggttccagttccc
agccagcagctctttgaacccagtcgagtatgcaagtcttgctatagcagcctacatccc
acaagctccagcattgaccttgaactggataagcccattgctgccacttccaactga

KEGG   Homo sapiens (human): 8898
Entry
8898              CDS       T01001                                 
Symbol
MTMR2, CMT4B, CMT4B1
Name
(RefSeq) myotubularin related protein 2
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Disease
H00264  Charcot-Marie-Tooth disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8898 (MTMR2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8898 (MTMR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8898 (MTMR2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     8898 (MTMR2)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     8898 (MTMR2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    8898 (MTMR2)
SSDB
Motif
Pfam: Myotub-related GRAM Y_phosphatase DSPc 3-PAP Y_phosphatase3 DUF4482
Other DBs
NCBI-GeneID: 8898
NCBI-ProteinID: NP_057240
OMIM: 603557
HGNC: 7450
Ensembl: ENSG00000087053
Pharos: Q13614(Tbio)
UniProt: Q13614
Structure
LinkDB
Position
11:complement(95832880..95924107)
AA seq 643 aa
MEKSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPD
LRVLRESNKLAEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERD
PPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLM
KYAFPVSNNLPLFAFEYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTY
PALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDE
KYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMR
ESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG
WDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVF
LQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSL
WSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKEL
LAKRAELQKKVEELQREISNRSTSSSERASSPAQCVTPVQTVV
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggagaagagctcgagctgcgagagtcttggctcccagccggcggcggctcggccgccc
agcgtggactccttgtccagtgcctccacttctcattcagagaattcagtgcatacaaaa
tcagcttctgttgtatcatcagattccatttcaacttctgccgacaacttttctcctgat
ttgagggtcctgagggagtctaacaagttagcagaaatggaagaaccacccttgcttcca
ggagaaaatattaaagacatggccaaagatgtaacttatatatgtccattcactggcgct
gtacgaggaactctgactgtcacgaattataggttatatttcaaaagcatggaacgggat
cccccatttgttttagatgcttcccttggtgtgataaatagagtagaaaaaattggtggt
gcttctagtcgaggtgaaaattcttatggactagaaactgtgtgtaaggatattaggaat
ttacgatttgctcataaacctgaggggcggacaagaagatccatatttgagaatctaatg
aaatatgcatttcctgtctctaataacctgcctctttttgcttttgaatacaaagaagta
ttccctgaaaatgggtggaagctatatgaccctcttttagagtatagaaggcagggaatt
ccaaatgaaagctggagaataacaaagataaatgaacgatatgaactttgtgatacatac
cctgccctcctggttgtgccagcaaatattcctgatgaagaattaaagagagtggcatcc
ttcagatcaagaggccgtatcccagttttatcatggattcatcctgaaagtcaagccaca
atcactcggtgtagccagcccatggttggagtgagtggaaagcgaagcaaagaagatgaa
aaataccttcaagctatcatggattccaatgcccagtctcacaaaatctttatatttgat
gcccggccaagtgttaatgctgttgccaacaaggcaaagggtggaggttatgaaagtgaa
gatgcctatcaaaatgctgaactagttttcctggatatccacaatattcatgttatgaga
gaatcattacgaaaacttaaggagattgtgtaccccaacattgaggaaacccactggttg
tctaacttggaatctactcattggctagaacatattaagcttattcttgcaggggctctt
aggattgctgacaaggtagagtcagggaagacgtctgtggtagtgcattgcagtgatggt
tgggatcgcacagctcagctcacttcccttgccatgctcatgttggatggatactatcga
accatccgaggatttgaagtccttgtggagaaagaatggctaagttttggacatcgattt
caactaagagttggccatggagataagaaccatgcagatgcagacagatcgcctgttttt
cttcaatttattgactgtgtctggcagatgacaagacagtttcctaccgcatttgaattc
aatgagtattttctcattaccattttggaccacctatacagctgcttattcggaacattc
ctctgtaatagtgaacaacagagaggaaaagagaatcttcctaaaaggactgtgtcactg
tggtcttacataaacagccagctggaagacttcactaatcctctctatgggagctattcc
aatcatgtcctttatccagtagccagcatgcgccacctagagctctgggtgggatattac
ataaggtggaatccacggatgaaaccacaggaacctattcacaacagatacaaagaactt
cttgctaaacgagcagagcttcagaaaaaagtagaggaactacagagagagatttctaac
cgatcaacctcatcctcagagagagccagctctcctgcacagtgtgtcactcctgtccaa
actgttgtataa

KEGG   Homo sapiens (human): 9107
Entry
9107              CDS       T01001                                 
Symbol
MTMR6
Name
(RefSeq) myotubularin related protein 6
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9107 (MTMR6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9107 (MTMR6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9107 (MTMR6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     9107 (MTMR6)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     9107 (MTMR6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    9107 (MTMR6)
SSDB
Motif
Pfam: Myotub-related Y_phosphatase DSPc DUF6051 Y_phosphatase3 GRAM
Other DBs
NCBI-GeneID: 9107
NCBI-ProteinID: NP_004676
OMIM: 603561
HGNC: 7453
Ensembl: ENSG00000139505
Pharos: Q9Y217(Tbio)
UniProt: Q9Y217
Structure
LinkDB
Position
13:complement(25246222..25287488)
AA seq 621 aa
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIASVEKLA
LTTSGCPLVIQCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSE
RLQGWQLIDLAEEYKRMGVPNSHWQLSDANRDYKICETYPRELYVPRIASKPIIVGSSKF
RSKGRFPVLSYYHQDKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPVNRYMYVMDTR
PKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVNDFYS
GLESSGWLRHIKAVMDAAIFLAKAITVENASVLVHCSDGWDRTSQVCSLGSLLLDSYYRT
IKGFMVLIEKDWISFGHKFSERCGQLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFSEA
FLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLEDQKKYLNPLYSSESHRF
TVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLESKIKQR
KNKQTDGILTKELLHSVHPESPNLKTSLCFKEQTLLPVNDALRTIEGSSPADNRYSEYAE
EFSKSEPAVVSLEYGVARMTC
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggagcatatccggacgaccaaggtcgaacaagtaaaattacttgaccgattcagtacc
agcaacaagtcattaacaggaacactgtatcttacggctacacatctattatttatcgac
tctcatcaaaaagaaacctggatattacaccaccatattgcctcagtagagaaacttgct
ttgactacttctggatgcccccttgtgatacagtgcaagaacttcagaactgtgcatttc
attgttcccagagaaagagattgccatgatatttacaactctttgctacaactgtcaaaa
caagcaaaatatgaagatctctatgcattttcttataatcccaaacaaaatgattcagaa
cgactacaaggctggcagctcattgatctcgctgaggaatataagaggatgggagtgcca
aactcacactggcagttgtctgatgccaaccgggactacaagatttgtgaaacttacccc
agagaactttatgttccccggatagcaagcaaaccaataattgttggtagttccaagttc
cggagcaagggaagattcccagttctttcctactatcatcaagataaggaggctgccatt
tgtcgatgtagtcagccactctctggattcagtgccaggtgcctggaggatgaacatttg
cttcaagccattagtaaagccaatccagtcaatcgctatatgtacgtcatggataccagg
ccaaaactgaatgcaatggccaacagagcagctggaaaaggttatgaaaatgaagacaac
tattccaatattagatttcagtttgttggaattgaaaatattcatgtcatgaggtccagc
cttcagaaattattggaagtcaatggcactaaagggctttctgtcaatgatttctactcc
ggtttggagagctcgggatggcttcgccatatcaaagctgttatggatgctgcaatcttc
ttggccaaagcaataacagttgaaaatgcaagtgtgttggtgcattgttccgatggttgg
gataggacttcccaggtttgttccctgggttctcttttattggattcctactacaggaca
atcaaaggattcatggttttaatagaaaaggattggatctcttttggacataaattttca
gagaggtgtggccagttggatggtgacccaaaggaagtctcaccagtgtttactcagttc
ttggaatgtgtgtggcatttgaccgaacagtttccacaagcctttgaattcagtgaagca
tttcttcttcagatccatgagcatattcattcatgccagtttggaaacttccttggaaat
tgtcagaaggaaagagaagagctcaagttgaaggagaagacttattccctgtggccattt
cttttggaagaccaaaagaagtacttaaatcctctctacagttccgaatctcacagattt
acagttttggagccaaatacagtatctttcaattttaagttttggaggaacatgtaccat
caatttgatcgaacactgcatcctaggcagtctgtatttaatataattatgaatatgaat
gagcaaaataaacaattagagaaagatattaaagacctagaatctaaaattaaacaacgc
aaaaataagcaaacagatggcatcctcaccaaggaattgttacattcagttcatcctgaa
tcacctaacctcaaaacttccctgtgttttaaagagcagactctgctacccgtaaatgat
gctcttcgaactatagagggcagcagcccggcagataatcgttatagtgaatatgcagaa
gagttttctaaatcagaacctgctgtggtcagcttagagtatggtgtggcaagaatgact
tgttag

KEGG   Homo sapiens (human): 9108
Entry
9108              CDS       T01001                                 
Symbol
MTMR7
Name
(RefSeq) myotubularin related protein 7
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9108 (MTMR7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9108 (MTMR7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9108 (MTMR7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     9108 (MTMR7)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     9108 (MTMR7)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    9108 (MTMR7)
SSDB
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase Y_phosphatase3 CREPT FapA DUF5320 CCDC53 Fzo_mitofusin
Other DBs
NCBI-GeneID: 9108
NCBI-ProteinID: NP_004677
OMIM: 603562
HGNC: 7454
Ensembl: ENSG00000003987
Pharos: Q9Y216(Tdark)
UniProt: Q9Y216 B7Z9Q7 B7ZAG8
LinkDB
Position
8:complement(17296794..17413351)
AA seq 660 aa
MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPDPRKETWILHSQISTIEK
QATTATGCPLLIRCKNFQIIQLIIPQERDCHDVYISLIRLARPVKYEELYCFSFNPMLDK
EEREQGWVLIDLSEEYTRMGLPNHYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSS
KFRSRRRFPVLSYYYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFVYVVD
TRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELKSPSMSDF
LWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCSVASLLLDPHY
RTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLMEQFPCAFEFN
ERFLIHIQHHIYSCQFGNFLCNSQKERRELKIQERTYSLWAHLWKNRADYLNPLFRADHS
QTQGTLHLPTTPCNFMYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEALEE
RLEKIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDYSGNMKSFPSRSPSQGDED
SALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFLTA
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggagcacatccgtacgcccaaggttgaaaatgtccgcttggtagatcgagtgtctcct
aaaaaagcagctctaggtactttgtatttgacggctacccatgtcatattcgtggaaaat
tcacctgacccaagaaaagaaacatggattcttcacagtcagatttccaccattgagaaa
caggcaacaaccgctaccggatgccctctgctgattcgctgcaagaactttcagataata
cagctcatcatacctcaggaaagagattgccacgacgtgtacatctccctgatacgcctt
gcaaggccagtgaaatatgaggagttatactgcttttcattcaaccccatgctggataaa
gaagaaagagagcaaggctgggtgctgatcgatcttagtgaagaatacacgcggatgggc
ctccctaatcattactggcagctcagcgatgtgaatagagactacagagtctgtgactct
tatcctactgaactgtacgttcccaaatcggccacggcacacatcatagtggggagttcc
aaattccggagtagacggcgatttcctgtcctttcttactattataaagataaccacgcc
tccatctgccggagcagccagcccctgtccggcttcagtgcccggtgcctagaggacgag
cagatgctccaggccattaggaaagccaatccaggaagtgacttcgtttatgtcgttgac
acccggcctaaacttaatgcaatggcaaatcgtgctgcagggaaaggctatgagaatgaa
gacaattattccaatatcaagtttcagtttatcgggatagagaacatccatgtcatgagg
aacagtctgcagaaaatgctggaagtgtgtgaacttaaatctccctccatgagtgatttc
ctgtggggtctggagaactctggctggttaaggcacattaaagccataatggatgcagga
atcttcattgcaaaggcagtgtcagaggaaggggcaagtgtgcttgttcactgttctgat
ggctgggacaggaccgctcaggtgtgctcggtggcaagcctgctgctggaccctcactac
cggactctgaagggcttcatggtattaattgaaaaggactggatttcctttggtcataag
tttaatcaccgatatggcaatctagatggtgacccaaaagaaatctctccagttattgac
cagttcattgagtgtgtttggcagttaatggaacaatttccctgtgcctttgagttcaat
gagaggtttttgattcacattcaacatcacatttattcctgccagtttggaaacttccta
tgtaacagccaaaaggagagacgagaactcaagattcaagaaagaacatactcattatgg
gctcacctgtggaagaatcgggccgactacctgaatcctctgtttagagctgatcacagc
cagactcagggaacccttcatctccctacaacaccatgtaacttcatgtacaagttttgg
agtggaatgtataaccgctttgaaaaggggatgcagccccgacagtcagttacagattac
ctaatggcagtgaaggaagaaactcagcagctagaggaagaactagaggccctggaagaa
aggctggaaaaaattcaaaaggtccagttaaattgcactaaggtgaagagtaagcaaagt
gagcccagcaagcactcagggttttctacctcagacaacagcatagccaacactccccag
gattacagtgggaatatgaaatcatttccatcccggagcccttcacaaggcgatgaagat
tctgctctgattctaacccaagacaatctgaaaagttcagatccagatctgtcagccaac
agtgaccaagagtccggggtggaggatttgagctgtcggtctccaagtggtggtgagcat
gcaccgagtgaagatagtggcaaggaccgggattctgatgaagccgtgtttctcactgcc
tga

KEGG   Homo sapiens (human): 9110
Entry
9110              CDS       T01001                                 
Symbol
MTMR4, FYVE-DSP2, ZFYVE11
Name
(RefSeq) myotubularin related protein 4
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9110 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9110 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9110 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9110 (MTMR4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     9110 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     9110 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     9110 (MTMR4)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    9110 (MTMR4)
SSDB
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Other DBs
NCBI-GeneID: 9110
NCBI-ProteinID: NP_004678
OMIM: 603559
HGNC: 7452
Ensembl: ENSG00000108389
Pharos: Q9NYA4(Tbio)
UniProt: Q9NYA4
LinkDB
Position
17:complement(58489537..58519047)
AA seq 1195 aa
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHISCKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRATGGSLSTGNNDTSEACDADFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENVEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPSSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEVRVGLEPWHSNPEGSETSFVD
SGVGGPQQTVGEVGLPPPLPSSQKDYLSNKPFKSHKSCSPSYKLLNTAVPREMKSNTSDP
EIKVLEETKGPAPDPSAQDELGRTLDGIGEPPEHCPETEAVSALSKVISNKCDGVCNFPE
SSQNSPTGTPQQAQPDSMLGVPSKCVLDHSLSTVCNPPSAACQTPLDPSTDFLNQDPSGS
VASISHQEQLSSVPDLTHGEEDIGKRGNNRNGQLLENPRFGKMPLELVRKPISQSQISEF
SFLGSNWDSFQGMVTSFPSGEATPRRLLSYGCCSKRPNSKQMRATGPCFGGQWAQREGVK
SPVCSSHSNGHCTGPGGKNQMWLSSHPKQVSSTKPVPLNCPSPVPPLYLDDDGLPFPTDV
IQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSD
TEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWLAKRRHHCRNCG
NVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQQLKKPIATASS
NT seq 3588 nt   +upstreamnt  +downstreamnt
atgggtgaggaggggccccccagcctggagtacatccaagccaaggatctgttccccccc
aaggaactagtgaaggaggaagagaatcttcaggtccccttcacagtgctgcagggtgag
ggagtagagttcctgggccgggcagccgatgccctcattgccatctctaactaccggctg
catatcaaattcaaggactctgtcatcaacgtccccctccggatgattgacagtgtggag
agccgtgatatgttccagttgcacatttcctgcaaggactccaaagtggtgaggtgccac
ttctccacttttaagcagtgccaagagtggctctcacggctaagccgagccacagcaaga
cctgccaagcctgaagacctctttgcctttgcctaccatgcctggtgcctggggctgacc
gaggaggaccagcacactcacctatgtcagccaggtgagcacatacgttgtcgacaggag
gcggagcttgcaaggatgggctttgacctgcagaacgtctggagagtctcacacatcaac
agcaactacaaattgtgccccagttacccccagaagctgctggttcctgtgtggatcact
gacaaagagctggagaacgtggcttccttccgctcctggaagcggattcccgtggttgtg
tatagacacttgcgcaatggggctgccatcgcccgctgcagccagccagagatcagctgg
tggggctggcgcaatgctgatgatgagtacctggtcacgtccattgctaaagcctgtgcc
ctggacccggggacaagggccactgggggctccctcagcaccgggaataatgataccagc
gaggcgtgtgatgctgactttgattcttctctgactgcgtgctctggagtggagagcaca
gcagctcctcaaaagctgctgatcctggatgcgcgatcctacacggcagcagtggccaac
cgggccaagggtggaggctgtgaatgtgaagagtactatcccaactgtgaggtcgtgttc
atgggaatggccaacatccatgccatccggaacagctttcagtacctccgggctgtgtgt
agccagatgccggatcctagcaactggttgtcggcactggagagtaccaaatggctgcag
cacttgtcggtgatgctaaaagcagctgtgctggtggctaatacagtagaccgggaaggc
cggcctgtgctggtacactgctcagatggctgggaccgcacaccgcagatcgtagccctg
gccaaaatattactggacccatattacaggacgttggagggcttccaagtgttagtggag
tctgactggctggattttgggcacaagtttggagatcgctgtggccaccaagagaatgtg
gaggaccaaaacgaacaatgccctgtgttcctccagtggcttgattctgttcatcagttg
cttaagcagttcccctgcctgtttgaatttaatgaagcattcctggtaaaactggtgcaa
cacacatactcctgcctctacggcaccttcctggccaacaacccctgtgagcgagagaag
cgcaacatctacaagcggacctgctctgtgtgggcgctccttcgagctggcaataaaaac
tttcataacttcctctacacacccagctcagacatggtcctgcatcctgtttgtcatgtc
cgggccctgcacctctggacagctgtttatctgccagcatcatctccatgcacacttggg
gaagaaaacatggatctttacctttccccagtggcccagagccaggagttctctggccgc
tctctggacagattacctaaaaccagatccatggatgatcttctttctgcctgtgacaca
agcagccccctgactcgtacatccagtgaccctaacctgaataaccactgtcaggaggtc
agggtaggcctggagccctggcacagcaatcctgagggatcagagacaagctttgtggac
tctggggtaggagggcctcagcaaactgtaggagaagtgggtcttcctcctcctctgccc
agcagccagaaagactacttgagcaataaacctttcaagagtcacaaaagctgttctcca
agttacaaactgcttaataccgcagtgcctcgggaaatgaagagcaacacctctgatcct
gagatcaaagtcctagaagagactaagggaccagctccagacccttctgcccaggatgag
ctgggtaggactttagatggcataggggagccacctgaacattgtcctgaaacagaagct
gtcagtgcactctccaaggtcatttctaacaagtgtgatggagtttgtaattttcctgag
tcttcccagaactctcctacaggtacgccccaacaggcccagccagactccatgctaggt
gtgccctccaagtgtgttcttgatcacagcctcagcaccgtttgcaacccaccgagtgct
gcctgccaaactcctctagacccaagcactgacttcctcaaccaagatccctcagggtct
gtggcaagtatctcccaccaggaacaactgagttctgtgccggatctgacccatggggag
gaagacattggtaaaagaggaaataataggaatgggcagttattggaaaatcctcgcttt
gggaaaatgccattggaattggtccggaagccaatttctcagagccagatcagtgagttc
tcttttctagggtccaactgggacagcttccaagggatggtgacttcattcccaagtggg
gaggccacccctcggcggctgctttcctatggctgttgtagcaagaggccaaacagtaag
cagatgcgggccacagggccctgctttgggggccagtgggctcagagagaaggtgtgaag
tcacctgtctgttctagtcattccaatggacattgtactggcccaggaggaaagaaccag
atgtggttgtccagtcatccaaagcaagtctctagcacaaagcccgttccactgaactgc
ccttctccagtgcctcctctgtatttggatgatgatggactcccctttcccacggatgtg
atccagcataggttacggcaaatcgaagcagggtacaaacaagaggtggagcagctacgt
cgacaggtgcgtgagcttcagatgaggctggacatccgtcactgctgtgcccctccagca
gagccccccatggactatgaggatgattttacatgtttgaaggagtcagatggcagtgat
actgaggattttggctctgatcacagtgaagactgcctttcagaagcaagctgggaacct
gttgataagaaagagactgaggtgactcgctgggttccagaccatatggcatcacactgc
tataactgtgactgtgaattctggttggccaaacgaagacaccattgcagaaattgtggg
aatgtattttgtgctggatgctgccacctgaagctgcccattcctgatcagcaactctat
gacccagttctcgtctgtaactcatgttacgaacacattcaagtctctcgtgccagggaa
ctcatgagccaacagctgaagaaacccattgctacagcttccagttga

DBGET integrated database retrieval system