KEGG   Homo sapiens (human): 463
Entry
463               CDS       T01001                                 
Symbol
ZFHX3, ATBF1, ATBT, C16orf47, ZFH-3, ZNF927
Name
(RefSeq) zinc finger homeobox 3
  KO
K09378  zinc finger homeobox protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H00024  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    463 (ZFHX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    463 (ZFHX3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ZF
    463 (ZFHX3)
SSDB
Motif
Pfam: Homeodomain zf-C2H2 zf-C2H2_4 Homeobox_KN zf-Di19 zf-H2C2_5 MIC19_MIC25 zf-met MerR_1 PALP
Other DBs
NCBI-GeneID: 463
NCBI-ProteinID: NP_008816
OMIM: 104155
HGNC: 777
Ensembl: ENSG00000140836
Vega: OTTHUMG00000137599
Pharos: Q15911(Tbio)
UniProt: Q15911 Q8N2Y6
Structure
LinkDB
Position
16:complement(72782885..73891930)
AA seq 3703 aa
MEGCDSPVVSGKDNGCGIPQHQQWTELNSTHLPDKPSSMEQSTGESHGPLDSLRAPFNER
LAESTASAGPPSEPASKEVTCNECSASFASLQTYMEHHCPSARPPPPLREESASDTGEEG
DEESDVENLAGEIVYQPDGSAYIVESLSQLTQGGGACGSGSGSGPLPSLFLNSLPGAGGK
QGDPSCAAPVYPQIINTFHIASSFGKWFEGPDQAFPNTSALAGLSPVLHSFRVFDVRHKS
NKDYLNSDGSAKSSCVSKDVPNNVDLSKFDGFVLYGKRKPILMCFLCKLSFGYVRSFVTH
AVHDHRMTLSEDERKILSNKNISAIIQGIGKDKEPLVSFLEPKNKNFQHPLVSTANLIGP
GHSFYGKFSGIRMEGEEALPAGSAAGPEQPQAGLLTPSTLLNLGGLTSSVLKTPITSVPL
GPLASSPTKSSEGKDSGAAEGEKQEVGDGDCFSEKVEPAEEEAEEEEEEEEAEEEEEEEE
EEEEEEEDEGCKGLFPSELDEELEDRPHEEPGAAAGSSSKKDLALSNQSISNSPLMPNVL
QTLSRGTASTSSNSASSFVVFDGANRRNRLSFNSEGVRANVAEGGRRLDFADESANKDNA
TAPEPNESTEGDDGGFVPHHQHAGSLCELGVGECPSGSGVECPKCDTVLGSSRSLGGHMT
MMHSRNSCKTLKCPKCNWHYKYQQTLEAHMKEKHPEPGGSCVYCKSGQPHPRLARGESYT
CGYKPFRCEVCNYSTTTKGNLSIHMQSDKHLNNMQNLQNGGGEQVFSHTAGAAAAAVAAA
AAAANISSSCGAPSPTKPKTKPTWRCEVCDYETNVARNLRIHMTSEKHMHNMMLLQQNMT
QIQHNRHLGLGSLPSPAEAELYQYYLAQNMNLPNLKMDSAASDAQFMMSGFQLDPAGPMA
AMTPALVGGEIPLDMRLGGGQLVSEELMNLGESFIQTNDPSLKLFQCAVCNKFTTDNLDM
LGLHMNVERSLSEDEWKAVMGDSYQCKLCRYNTQLKANFQLHCKTDKHVQKYQLVAHIKE
GGKANEWRLKCVAIGNPVHLKCNACDYYTNSLEKLRLHTVNSRHEASLKLYKHLQQHESG
VEGESCYYHCVLCNYSTKAKLNLIQHVRSMKHQRSESLRKLQRLQKGLPEEDEDLGQIFT
IRRCPSTDPEEAIEDVEGPSETAADPEELAKDQEGGASSSQAEKELTDSPATSKRISFPG
SSESPLSSKRPKTAEEIKPEQMYQCPYCKYSNADVNRLRVHAMTQHSVQPMLRCPLCQDM
LNNKIHLQLHLTHLHSVAPDCVEKLIMTVTTPEMVMPSSMFLPAAVPDRDGNSNLEEAGK
QPETSEDLGKNILPSASTEQSGDLKPSPADPGSVREDSGFICWKKGCNQVFKTSAALQTH
FNEVHAKRPQLPVSDRHVYKYRCNQCSLAFKTIEKLQLHSQYHVIRAATMCCLCQRSFRT
FQALKKHLETSHLELSEADIQQLYGGLLANGDLLAMGDPTLAEDHTIIVEEDKEEESDLE
DKQSPTGSDSGSVQEDSGSEPKRALPFRKGPNFTMEKFLDPSRPYKCTVCKESFTQKNIL
LVHYNSVSHLHKLKRALQESATGQPEPTSSPDNKPFKCNTCNVAYSQSSTLEIHMRSVLH
QTKARAAKLEAASGSSNGTGNSSSISLSSSTPSPVSTSGSNTFTTSNPSSAGIAPSSNLL
SQVPTESVGMPPLGNPIGANIASPSEPKEANRKKLADMIASRQQQQQQQQQQQQQQQQQQ
QAQTLAQAQAQVQAHLQQELQQQAALIQSQLFNPTLLPHFPMTTETLLQLQQQQHLLFPF
YIPSAEFQLNPEVSLPVTSGALTLTGTGPGLLEDLKAQVQVPQQSHQQILPQQQQNQLSI
AQSHSALLQPSQHPEKKNKLVIKEKEKESQRERDSAEGGEGNTGPKETLPDALKAKEKKE
LAPGGGSEPSMLPPRIASDARGNATKALLENFGFELVIQYNENKQKVQKKNGKTDQGENL
EKLECDSCGKLFSNILILKSHQEHVHQNYFPFKQLERFAKQYRDHYDKLYPLRPQTPEPP
PPPPPPPPPPLPAAPPQPASTPAIPASAPPITSPTIAPAQPSVPLTQLSMPMELPIFSPL
MMQTMPLQTLPAQLPPQLGPVEPLPADLAQLYQHQLNPTLLQQQNKRPRTRITDDQLRVL
RQYFDINNSPSEEQIKEMADKSGLPQKVIKHWFRNTLFKERQRNKDSPYNFSNPPITSLE
ELKIDSRPPSPEPPKQEYWGSKRSSRTRFTDYQLRVLQDFFDANAYPKDDEFEQLSNLLN
LPTRVIVVWFQNARQKARKNYENQGEGKDGERRELTNDRYIRTSNLNYQCKKCSLVFQRI
FDLIKHQKKLCYKDEDEEGQDDSQNEDSMDAMEILTPTSSSCSTPMPSQAYSAPAPSANN
TASSAFLQLTAEAEELATFNSKTEAGDEKPKLAEAPSAQPNQTQEKQGQPKPELQQQEQP
EQKTNTPQQKLPQLVSLPSLPQPPPQAPPPQCPLPQSSPSPSQLSHLPLKPLHTSTPQQL
ANLPPQLIPYQCDQCKLAFPSFEHWQEHQQLHFLSAQNQFIHPQFLDRSLDMPFMLFDPS
NPLLASQLLSGAIPQIPASSATSPSTPTSTMNTLKRKLEEKASASPGENDSGTGGEEPQR
DKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERKGQ
FRAVGPAQAHRRCPFCRALFKAKTALEAHIRSRHWHEAKRAGYNLTLSAMLLDCDGGLQM
KGDIFDGTSFSHLPPSSSDGQGVPLSPVSKTMELSPRTLLSPSSIKVEGIEDFESPSMSS
VNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAM
MAMSEYEDRLSSGLVSPAPSFYSKEYDNEGTVDYSETSSLADPCSPSPGASGSAGKSGDS
GDRPGQKRFRTQMTNLQLKVLKSCFNDYRTPTMLECEVLGNDIGLPKRVVQVWFQNARAK
EKKSKLSMAKHFGINQTSYEGPKTECTLCGIKYSARLSVRDHIFSQQHISKVKDTIGSQL
DKEKEYFDPATVRQLMAQQELDRIKKANEVLGLAAQQQGMFDNTPLQALNLPTAYPALQG
IPPVLLPGLNSPSLPGFTPSNTALTSPKPNLMGLPSTTVPSPGLPTSGLPNKPSSASLSS
PTPAQATMAMGPQQPPQQQQQQQQPQVQQPPPPPAAQPPPTPQLPLQQQQQRKDKDSEKV
KEKEKAHKGKGEPLPVPKKEKGEAPTATAATISAPLPTMEYAVDPAQLQALQAALTSDPT
ALLTSQFLPYFVPGFSPYYAPQIPGALQSGYLQPMYGMEGLFPYSPALSQALMGLSPGSL
LQQYQQYQQSLQEAIQQQQQRQLQQQQQQKVQQQQPKASQTPVPPGAPSPDKDPAKESPK
PEEQKNTPREVSPLLPKLPEEPEAESKSADSLYDPFIVPKVQYKLVCRKCQAGFSDEEAA
RSHLKSLCFFGQSVVNLQEMVLHVPTGGGGGGSGGGGGGGGGGGGGGSYHCLACESALCG
EEALSQHLESALHKHRTITRAARNAKEHPSLLPHSACFPDPSTASTSQSAAHSNDSPPPP
SAAAPSSASPHASRKSWPQVVSRASAAKPPSFPPLSSSSTVTSSSCSTSGVQPSMPTDDY
SEESDTDLSQKSDGPASPVEGPKDPSCPKDSGLTSVGTDTFRL
NT seq 11112 nt   +upstreamnt  +downstreamnt
atggaaggctgtgactcgcccgtcgtctcggggaaggacaatgggtgcggtatccctcag
caccagcaatggactgaactcaacagcacccacctccctgacaaacccagtagcatggag
cagtccacaggcgagagccacgggcccttggacagcctgagggcccccttcaatgagcgc
ctcgcggagagcaccgcgtcggccgggcccccctccgagcccgccagcaaggaggtcacc
tgcaacgaatgttcggcctcctttgccagcctccagacctacatggagcaccactgcccc
agcgcgcgccccccgccacccctgagagaggagagcgccagcgacaccggtgaggagggg
gacgaggagagtgacgtggagaacctggccggggagatcgtctaccagccggacggctcc
gcgtacattgtggagagcctgagccagctgacccagggcgggggcgcctgtgggagtggc
agtggcagtgggcctctcccctcgcttttcctgaactctctccctggcgcggggggcaag
caaggggacccttcgtgtgctgcacccgtgtacccgcagatcatcaacactttccacata
gcctcatccttcgggaaatggtttgagggcccagaccaggctttcccgaatacctcagcc
ctggcggggctcagccccgtcctgcacagcttccgcgtgtttgacgtgcgacacaaaagc
aacaaggattacctgaacagcgacggttctgccaaaagctcctgcgtatccaaagatgtt
cccaacaatgtggacctgtccaaattcgatggctttgtgctctatggcaagaggaagccc
atcctgatgtgtttcttgtgcaaactctcctttgggtacgtccgttcgtttgtgacccac
gcggtgcatgaccatcgaatgaccctgagcgaagacgagcggaaaattcttagcaataag
aacatctccgctatcatccaagggatcggcaaagacaaggaaccccttgtaagttttctg
gaaccaaaaaacaaaaactttcaacaccctttagtttccacagctaacctcataggcccc
ggacacagtttttatggtaaatttagtggcattcgaatggaaggggaggaagctctccca
gcgggctccgccgctggccccgagcagccccaggctggtctcttgacccccagcaccctg
ttgaaccttggcgggctcaccagctcggtactgaagacccccattacctcagtccccctg
gggcctctggcttccagtcctaccaaatcctcagagggcaaggactctggggcggcagaa
ggagagaagcaggaagtgggcgacggggattgcttctctgagaaggtagagccagccgaa
gaggaggcggaggaggaagaggaggaggaagaggcggaggaggaggaggaagaagaggag
gaggaagaagaggaggaggaagacgagggttgcaaaggactctttccaagcgagttggat
gaggaactggaggacaggccccatgaggagcctggggccgcagcaggtagtagcagcaaa
aaggaccttgctctctcaaaccaaagcatttctaactcccccttaatgcctaacgtgctc
cagaccctgtcgaggggcacagcttctactagttctaattctgcttcttcctttgttgtc
tttgatggtgcgaacaggaggaatcgtttaagctttaacagtgagggcgtcagggccaat
gtggcagagggcggcaggaggctggacttcgctgacgaaagtgccaataaagacaatgcc
acagcaccagaaccaaatgaaagcacagagggtgacgatgggggcttcgttccccatcac
cagcacgctggctccctctgcgagcttggggttggggagtgcccctcggggagtggcgtg
gagtgccccaaatgcgacacggtcctgggctcctcccgctcgctgggcggccacatgacc
atgatgcattctcgtaactcgtgtaagacactcaagtgccccaagtgcaactggcactat
aagtaccagcagaccctggaggcacacatgaaggagaagcacccggagccggggggctcc
tgtgtctactgcaaaagcgggcagccccacccccggctggcacgaggcgagagctacacg
tgtggttacaagcctttccgctgcgaggtgtgtaactactccacaactaccaaaggcaac
ctcagtattcatatgcagtctgacaagcatctcaacaacatgcagaacctgcagaatgga
gggggggagcaggtcttcagccacactgccggggcggcggcggcggcggtggctgcggcg
gcggcggcagccaatatcagtagctcctgcggggccccctcgccgaccaaaccaaaaacc
aaacccacctggcggtgcgaggtgtgtgattatgagaccaacgtggccaggaacctccgc
attcacatgaccagtgagaagcacatgcataacatgatgttactgcaacagaacatgacc
cagatccaacacaaccgccacctgggcctcggcagcctgccctcacccgccgaggccgag
ctctaccaatactacctggcccagaacatgaacctgcccaacctgaagatggacagtgct
gcctcggacgcccagttcatgatgagcggattccagctggatcccgccgggcccatggcc
gccatgacgcctgctctagtgggcggtgagatccccctagacatgcggctcgggggcggg
cagctggtgtcagaggagctgatgaacctgggcgagagcttcatccagaccaacgacccg
tcgctgaagctcttccagtgcgccgtctgcaacaagttcacgacggacaacctggacatg
ctgggcctgcacatgaacgtggagcgcagcctgtcggaggacgagtggaaggcggtgatg
ggggactcataccagtgcaagctctgccgctacaacacccagctcaaggccaacttccag
ctgcactgcaagacagacaagcacgtgcagaagtaccagctggtggcccacatcaaggag
ggcggcaaggccaacgagtggaggctcaagtgtgtggccatcggcaaccccgtgcacctc
aagtgcaacgcctgtgactactacaccaacagcctggagaagctgcggctgcacacggtc
aactccaggcacgaggccagcctgaagttgtacaagcacctgcagcagcatgagagtggt
gtagaaggtgagagctgctactaccactgcgttctgtgcaactactccaccaaggccaag
ctcaacctcatccagcatgtgcgctccatgaagcaccagcgaagcgagagcctgcgaaag
ctgcagcggctgcagaagggccttccagaggaggacgaggacctggggcagatcttcacc
atccgcaggtgcccctccacggacccagaagaagccattgaagatgttgaaggacccagt
gaaacagctgctgatccagaggagcttgctaaggaccaagagggcggagcatcgtccagc
caagcagagaaggagctgacagattctcctgcaacctccaaacgcatctccttcccaggt
agctcagagtctcccctctcttcgaagcgaccaaaaacagctgaggagatcaaaccggag
cagatgtaccagtgtccctactgcaagtacagtaatgccgatgtcaaccggctccgggtg
catgccatgacgcagcactcggtgcaacccatgcttcgctgccccctgtgccaggacatg
ctcaacaacaagatccacctccagctgcacctcacccacctccacagcgtggcacctgac
tgcgtggagaagctcattatgacggtgaccacccctgagatggtgatgccaagcagcatg
ttcctcccagcagctgttccagatcgagatgggaattccaatttggaagaggcaggaaag
cagcctgaaacctcagaggatctgggaaagaacatcttgccatccgcaagcacagagcaa
agcggagatttgaaaccatcccctgctgacccaggctctgtgagagaagactcaggcttc
atctgctggaagaaggggtgcaaccaggttttcaaaacttctgctgcccttcagacgcat
tttaatgaagtgcatgccaagaggcctcagctgccggtgtcagatcgccatgtgtacaag
taccgctgtaatcagtgtagcctggccttcaagaccattgaaaagttgcagctccattct
cagtaccatgtgatcagagctgccaccatgtgctgtctttgtcagcgcagtttccgaact
ttccaggctctgaagaagcaccttgagacaagccacctggagctgagtgaggctgacatc
caacagctttatggtggcctgctggccaatggggacctcctggcaatgggagaccccact
ctggcagaggaccataccataattgttgaggaagacaaggaggaagagagtgacttggaa
gataaacagagcccaacgggcagtgactctgggtcagtacaagaagactcgggctcagag
ccaaagagagctctgcctttcagaaaaggtcccaattttactatggaaaagttcctagac
ccttctcgcccttacaagtgtaccgtctgcaaggaatctttcactcaaaagaatatcctg
ctagtacactacaattctgtctcccacctgcataagttaaagagagcccttcaagaatca
gcaaccggtcagccagaacccaccagcagcccagacaacaaaccttttaagtgtaacact
tgtaatgtggcctacagccagagttccactctggagatccatatgaggtctgtgttacat
caaaccaaggcccgggcagccaagctggaggctgcaagtggcagcagcaatgggactggg
aacagcagcagtatttccttgagctcctccacgccaagtcctgtgagcaccagtggcagt
aacacctttaccacctccaatccaagcagtgctggcattgctccaagctctaacttacta
agccaagtgcccactgagagtgtagggatgccacccctggggaatcctattggtgccaac
attgcttccccttcagagcccaaagaggccaatcggaagaaactggcagatatgattgca
tccaggcagcagcaacaacagcagcagcaacagcaacaacaacaacaacaacaacaacaa
caagcacaaacgctggcccaggcccaggctcaagttcaagctcacctgcagcaggagctg
cagcaacaggctgccctgatccagtctcagctgtttaaccccaccctccttcctcacttc
cccatgacaactgagaccctgctgcaactacagcagcagcagcacctcctcttccctttc
tacatccccagtgctgagttccagcttaaccccgaggtgagcttgccagtgaccagtggg
gcactgacactgactgggacaggcccaggcctgctggaagatctgaaggctcaggttcag
gtcccacagcagagccatcagcagatcttgccgcagcagcagcagaaccaactctctata
gcccagagtcactctgccctccttcagccaagccagcaccccgaaaagaagaacaaattg
gtcatcaaagaaaaggaaaaagaaagccagagagagagggacagcgccgaggggggagag
ggcaacaccggtccgaaggaaacactgccagatgccttgaaggccaaagagaagaaagag
ttggcaccagggggtggttctgagccttccatgctccctccacgcattgcttcagatgcc
agagggaacgccaccaaggccctgctggagaactttggctttgagttggtcatccagtat
aatgagaacaagcagaaggtgcagaaaaagaatgggaagactgaccagggagagaacctg
gaaaagctcgagtgtgactcctgcggcaagttgttttccaacatcttgattttaaagagt
catcaagagcacgttcatcagaattactttcctttcaaacagctcgagaggtttgccaaa
cagtacagagaccactacgataaactgtacccactgaggccccagaccccagagccacca
ccacctccccctccaccccctccacccccacttccggcagcgccgcctcagccggcgtcc
acaccagccatccccgcatcagccccacccatcacctcacctacaattgcaccggcccag
ccatcagtgccgctcacccagctctccatgccgatggagctgcccatcttctcgccgctg
atgatgcagacgatgccgctgcagaccttgccggctcagctacccccgcagctgggacct
gtggagcctctgcctgcggacctggcccaactctaccagcatcagctcaatccaaccctg
ctccagcagcagaacaagaggcctcgcaccaggatcacagatgatcagctccgagtcttg
cggcaatattttgacattaacaactcccccagtgaagagcaaataaaagagatggcagac
aagtccgggttgccccagaaagtgatcaagcactggttcaggaacactctcttcaaagag
aggcagcgtaacaaggactccccttacaacttcagtaatcctcctatcaccagcctggag
gagctcaagattgactcccggcccccttcgccggaacctccaaagcaggagtactgggga
agcaagaggtcttcaagaacaaggtttacggactaccagctgagggtcttacaggacttc
ttcgatgccaatgcttacccaaaggatgatgaatttgagcaactctctaatttactgaac
cttccaacccgagtgatagtggtgtggtttcagaatgcccgacagaaggccaggaagaat
tatgagaatcagggagagggcaaagatggagagcggcgtgagcttacaaatgatagatac
attcgaacaagcaacttgaactaccagtgcaaaaaatgtagcctggtgtttcagcgcatc
tttgatctcatcaagcaccagaagaagctgtgttacaaggatgaggatgaggaggggcag
gacgacagccaaaatgaggattccatggatgccatggaaatcctgacgcctaccagctca
tcctgcagtaccccgatgccctcacaggcttacagcgccccagcaccatcagccaataat
acagcttcctccgctttcttgcagcttacagcggaggctgaggaactggccaccttcaat
tcaaaaacagaggcaggcgatgagaaaccaaagctggcggaagctcccagtgcacagcca
aaccaaacccaagaaaagcaaggacaaccaaagccagagctgcagcagcaagagcagccc
gagcagaagaccaacactccccagcagaagctcccccagctggtgtccctgccttcgttg
ccacagcctcctccacaagcgccccctccacagtgccccttaccccagtcgagccccagt
ccttcccagctctcccacctgcccctcaagcccctccacacatcaactcctcaacagctc
gcaaacctacctcctcagctaatcccctaccagtgtgaccagtgtaagttggcatttccg
tcatttgagcactggcaggagcatcagcagctccacttcctgagcgcgcagaaccagttc
atccacccccagtttttggacaggtccctggatatgcctttcatgctctttgatcccagt
aacccactcctggccagccagctgctctctggggccatacctcagattccagcaagctca
gccacttctccttcaactccaacctccacaatgaacactctcaagaggaagctggaggaa
aaggccagtgcaagccctggcgaaaacgacagtgggacaggaggagaagagcctcagaga
gacaagcgtttgagaacaaccatcacaccggaacaactagaaattctctaccagaagtat
ctactggattccaatccgactcgaaagatgttggatcacattgcacacgaggtgggcttg
aagaaacgtgtggtacaagtctggtttcagaacacccgagctcgggaaaggaaaggacag
ttccgggctgtaggcccagcgcaggcccacaggagatgccctttttgcagagcgctcttc
aaagccaagactgctcttgaggctcatatccggtcccgtcactggcatgaagccaagaga
gctggctacaacctaactctgtctgcgatgctcttagactgtgatgggggactccagatg
aaaggagatatttttgacggaactagcttttcccacctacccccaagcagtagtgatggt
cagggtgtccccctctcacctgtgagtaaaaccatggaattgtcacccagaactcttcta
agcccttcctccattaaggtggaagggattgaagactttgaaagcccctccatgtcctca
gttaatctaaactttgaccaaactaagctggacaacgatgactgttcctctgtcaacaca
gcaatcacagataccacaactggagacgagggcaacgcagataacgacagtgcaacggga
atagcaactgaaaccaaatcctcttctgcacccaacgaagggttgaccaaagcggccatg
atggcaatgtctgagtatgaagatcggttgtcatctggtctggtcagcccggccccgagc
ttttatagcaaggaatatgacaatgaaggtacagtggactacagtgaaacctcaagcctt
gcagatccctgctccccgagtcctggtgcgagtggatctgcaggcaaatctggtgacagc
ggagatcggcctgggcagaaacgttttcgcactcaaatgaccaatctgcagctgaaggtc
ctcaagtcatgctttaatgactacaggacacccactatgctagaatgtgaggtcctgggc
aatgacattggactgccaaagagagtcgttcaggtctggttccagaatgcccgggcaaaa
gaaaagaagtccaagttaagcatggccaagcattttggtataaaccaaacgagttatgag
ggacccaaaacagagtgcactttgtgtggcatcaagtacagcgctcggctgtctgtacgt
gaccatatcttttcccaacagcatatctccaaagttaaagacaccattggaagccagctg
gacaaggagaaagaatactttgacccagccaccgtacgtcagttgatggctcaacaagag
ttggaccggattaaaaaggccaacgaggtccttggactggcagctcagcagcaagggatg
tttgacaacacccctcttcaggcccttaaccttcctacagcatatccagcgctccagggc
attcctcctgtgttgctcccgggcctcaacagcccctccttgccaggctttactccatcc
aacacagctttaacgtctcctaagccgaacttgatgggtctgcccagcacaactgttcct
tcccctggcctccccacttctggattaccaaataaaccgtcctcagcgtcgctgagctcc
ccaaccccagcacaagccacgatggcgatgggccctcagcaacccccccagcagcagcag
cagcagcagcaaccacaggtgcagcagcctcccccgccgccagcagcccagccgccaccc
acaccacagctcccactgcaacagcagcagcaacgcaaggacaaagacagtgagaaagta
aaggagaaggaaaaggcacacaaagggaaaggggaacccctgcctgtccccaagaaggag
aaaggagaggcccccacggcaactgcagccacgatctcagccccgctgcccaccatggag
tatgcggtagaccctgcacagctgcaggccctgcaggccgcgttgacttcggaccccaca
gcattgctcacaagccagttccttccttactttgtaccaggcttttctccttattatgct
ccccagatccctggcgccctgcagagcgggtacctgcagcctatgtatggcatggaaggc
ctgttcccctacagccctgcactgtcgcaggccctgatggggctgtccccaggctcccta
ctgcagcagtaccagcaataccagcagagtctgcaggaggcaattcagcagcagcagcag
cggcaactacagcagcagcagcagcaaaaagtgcagcagcagcagcccaaagcaagccaa
accccagtcccccccggggctccttccccagacaaagaccctgccaaagaatcccccaaa
ccagaagaacagaaaaacaccccccgtgaggtgtcccccctcctgccgaaactccctgaa
gagccagaagcagaaagcaaaagtgcggactccctctacgaccccttcattgttccaaag
gtgcagtacaagttggtctgccgcaagtgccaggcgggcttcagcgacgaggaggcagcg
aggagccacctgaagtccctctgcttcttcggccagtctgtggtgaacctgcaagagatg
gtgcttcacgtccccaccggcggcggcggcggtggcagtggcggcggcggcggcggtggc
ggcggcggcggcggcggcggctcgtaccactgcctggcgtgcgagagcgcgctctgtggg
gaggaagctctgagtcaacatctcgagtcggccttgcacaaacacagaacaatcacgaga
gcagcaagaaacgccaaagagcaccctagtttattacctcactctgcctgcttccccgat
cctagcaccgcatctacctcgcagtctgccgctcactcaaacgacagcccccctcccccg
tcggccgccgccccctcctccgcttccccccacgcctccaggaagtcttggccgcaagtg
gtctcccgggcttcggcagcgaagcccccttcttttcctcctctctcctcatcttcaacg
gttacctcaagttcatgcagcacctcaggggttcagccctcgatgccaacagacgactat
tcggaggagtctgacacggatctcagccaaaagtccgacggaccggcgagcccggtggag
ggtcccaaagaccccagctgccccaaggacagtggtctgaccagtgtaggaacggacacc
ttcagattgtaa

DBGET integrated database retrieval system