KEGG   Homo sapiens (human): 4762
Entry
4762              CDS       T01001                                 
Symbol
NEUROG1, AKA, Math4C, NEUROD3, bHLHa6, ngn1
Name
(RefSeq) neurogenin 1
  KO
K09081  neurogenin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4762 (NEUROG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4762 (NEUROG1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    4762 (NEUROG1)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 4762
NCBI-ProteinID: NP_006152
OMIM: 601726
HGNC: 7764
Ensembl: ENSG00000181965
Vega: OTTHUMG00000129138
Pharos: Q92886(Tbio)
UniProt: Q92886 F1T0H3
LinkDB
Position
5:complement(135534282..135535964)
AA seq 237 aa
MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASE
VPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPA
SDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFPSLPKDLLHTTPCFIPYH
NT seq 714 nt   +upstreamnt  +downstreamnt
atgccagcccgccttgagacctgcatctccgacctcgactgcgccagcagcagcggcagt
gacctatccggcttcctcaccgacgaggaagactgtgccagactccaacaggcagcctcc
gcttcggggccgcccgcgccggcccgcaggggcgcgcccaatatctcccgggcgtctgag
gttccaggggcacaggacgacgagcaggagaggcggcggcgccgcggccggacgcgggtc
cgctccgaggcgctgctgcactcgctgcgcaggagccggcgcgtcaaggccaacgatcgc
gagcgcaaccgcatgcacaacttgaacgcggccctggacgcactgcgcagcgtgctgccc
tcgttccccgacgacaccaagctcaccaaaatcgagacgctgcgcttcgcctacaactac
atctgggctctggccgagacactgcgcctggcggatcaagggctgcccggaggcggtgcc
cgggagcgcctcctgccgccgcagtgcgtcccctgcctgcccggtcccccaagccccgcc
agcgacgcggagtcctggggctcaggtgccgccgccgcctccccgctctctgaccccagt
agcccagccgcctccgaagacttcacctaccgccccggcgaccctgttttctccttccca
agcctgcccaaagacttgctccacacaacgccctgtttcattccttaccactag

DBGET integrated database retrieval system