KEGG   Homo sapiens (human): 4852
Entry
4852              CDS       T01001                                 
Symbol
NPY, PYY4
Name
(RefSeq) neuropeptide Y
  KO
K05232  neuropeptide Y
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04920  Adipocytokine signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    4852 (NPY)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4852 (NPY)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    4852 (NPY)
   04920 Adipocytokine signaling pathway
    4852 (NPY)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    4852 (NPY)
SSDB
Motif
Pfam: Hormone_3
Other DBs
NCBI-GeneID: 4852
NCBI-ProteinID: NP_000896
OMIM: 162640
HGNC: 7955
Ensembl: ENSG00000122585
Pharos: P01303(Tbio)
CPD: C15949
UniProt: P01303 A4D158
Structure
LinkDB
Position
7:24284190..24291862
AA seq 97 aa
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
NT seq 294 nt   +upstreamnt  +downstreamnt
atgctaggtaacaagcgactggggctgtccggactgaccctcgccctgtccctgctcgtg
tgcctgggtgcgctggccgaggcgtacccctccaagccggacaacccgggcgaggacgca
ccagcggaggacatggccagatactactcggcgctgcgacactacatcaacctcatcacc
aggcagagatatggaaaacgatccagcccagagacactgatttcagacctcttgatgaga
gaaagcacagaaaatgttcccagaactcggcttgaagaccctgcaatgtggtga

KEGG   Homo sapiens (human): 5539
Entry
5539              CDS       T01001                                 
Symbol
PPY, PNP, PP
Name
(RefSeq) pancreatic polypeptide
  KO
K05234  pancreatic polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5539 (PPY)
SSDB
Motif
Pfam: Hormone_3
Other DBs
NCBI-GeneID: 5539
NCBI-ProteinID: NP_002713
OMIM: 167780
HGNC: 9327
Ensembl: ENSG00000108849
Pharos: P01298(Tbio)
CPD: C16117
UniProt: P01298
Structure
LinkDB
Position
17:complement(43940804..43944215)
AA seq 95 aa
MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINML
TRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
NT seq 288 nt   +upstreamnt  +downstreamnt
atggctgccgcacgcctctgcctctccctgctgctcctgtccacctgcgtggctctgtta
ctacagccactgctgggtgcccagggagccccactggagccagtgtacccaggggacaat
gccacaccagagcagatggcccagtatgcagctgatctccgtagatacatcaacatgctg
accaggcctaggtatgggaaaagacacaaagaggacacgctggccttctcggagtggggg
tccccgcatgctgctgtccccagggagctcagcccgctggacttataa

KEGG   Homo sapiens (human): 5697
Entry
5697              CDS       T01001                                 
Symbol
PYY, PYY-I, PYY1
Name
(RefSeq) peptide YY
  KO
K05233  peptide YY
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5697 (PYY)
SSDB
Motif
Pfam: Hormone_3 DUF4733
Other DBs
NCBI-GeneID: 5697
NCBI-ProteinID: NP_004151
OMIM: 600781
HGNC: 9748
Ensembl: ENSG00000131096
Pharos: P10082(Tbio)
CPD: C16118
UniProt: P10082
Structure
LinkDB
Position
17:complement(43952733..44004445)
AA seq 97 aa
MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVT
RQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW
NT seq 294 nt   +upstreamnt  +downstreamnt
atggtgttcgtgcgcaggccgtggcccgccttgaccacagtgcttctggccctgctcgtc
tgcctaggggcgctggtcgacgcctaccccatcaaacccgaggctccccgcgaagacgcc
tcgccggaggagctgaaccgctactacgcctccctgcgccactacctcaacctggtcacc
cggcagcggtatgggaaaagagacggcccggacacgcttctttccaaaacgttcttcccc
gacggcgaggaccgccccgtcaggtcgcggtcggagggcccagacctgtggtga

DBGET integrated database retrieval system