KEGG   Homo sapiens (human): 494143
Entry
494143            CDS       T01001                                 
Symbol
CHAC2, GCG1
Name
(RefSeq) ChaC glutathione specific gamma-glutamylcyclotransferase 2
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    494143 (CHAC2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     494143 (CHAC2)
SSDB
Motif
Pfam: ChaC GGACT
Other DBs
NCBI-GeneID: 494143
NCBI-ProteinID: NP_001008708
OMIM: 617446
HGNC: 32363
Ensembl: ENSG00000143942
Vega: OTTHUMG00000151824
Pharos: Q8WUX2(Tdark)
UniProt: Q8WUX2
Structure
LinkDB
Position
2:53767783..53775196
AA seq 184 aa
MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCV
WGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLG
PAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQN
LNCI
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtgggtttttggttacgggtccctgatctggaaggtggatttcccctatcaggacaag
ctggtcggatacatcaccaactacagcaggcgcttctggcagggcagcacggaccaccgc
ggggtccccggcaagcctggaagagttgtgactcttgttgaagatcctgcgggatgtgta
tggggtgttgcttacagattgccagtaggaaaggaagaagaagtaaaagcataccttgac
ttcagagaaaaaggaggctacagaaccacaacagtcattttttatccaaaagatcccaca
acaaaaccattcagtgtattgctatatattggaacatgtgataatcctgattatcttggt
cctgcacctctggaagacattgctgaacaaatttttaatgcagctggtccaagtggaaga
aatacagaatatctttttgaacttgcaaattctattaggaaccttgtgccagaagaagca
gatgagcatcttttcgctttggaaaaattagtaaaggaacgtttagaagggaaacagaac
ctcaattgcatataa

KEGG   Homo sapiens (human): 79094
Entry
79094             CDS       T01001                                 
Symbol
CHAC1
Name
(RefSeq) ChaC glutathione specific gamma-glutamylcyclotransferase 1
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    79094 (CHAC1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     79094 (CHAC1)
SSDB
Motif
Pfam: ChaC GGACT
Other DBs
NCBI-GeneID: 79094
NCBI-ProteinID: NP_077016
OMIM: 614587
HGNC: 28680
Ensembl: ENSG00000128965
Vega: OTTHUMG00000130208
Pharos: Q9BUX1(Tbio)
UniProt: Q9BUX1
LinkDB
Position
15:40953471..40956512
AA seq 222 aa
MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGY
SRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGG
YDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLL
RLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
NT seq 669 nt   +upstreamnt  +downstreamnt
atgaagcaggagtctgcagccccgaacaccccgcccacctcgcagtcccctacgccgtcc
gctcagttcccccgaaacgacggcgaccctcaagcgctgtggattttcgggtacggctcc
ctggtgtggaggcccgacttcgcctacagcgacagccgtgtgggcttcgtgcgcggctac
agccgccgtttctggcagggagacaccttccatcggggcagcgacaagatgcctggccgt
gtggtgacgctccttgaagatcatgagggctgcacttggggcgtggcataccaagtgcaa
ggggagcaggtaagcaaggccctgaagtacctgaatgtgcgagaggcagtgcttggtggc
tacgataccaaggaggtcaccttctatccccaagatgctcctgaccaaccactgaaggca
ttggcctatgtggccaccccacagaaccctggttacctgggccctgcgcctgaagaggcc
attgccacgcagatcctggcctgccggggcttctccggccacaaccttgaatacttgctg
cgtctggcagacttcatgcagctctgtgggcctcaggcgcaggacgagcacctggcagcc
atcgtggacgctgtgggcaccatgttgccctgcttctgccccaccgagcaggctctggcg
ctggtgtga

DBGET integrated database retrieval system