KEGG   Homo sapiens (human): 5013
Entry
5013              CDS       T01001                                 
Symbol
OTX1
Name
(RefSeq) orthodenticle homeobox 1
  KO
K09326  homeobox protein OTX1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5013 (OTX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5013 (OTX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    5013 (OTX1)
SSDB
Motif
Pfam: TF_Otx Homeodomain SatD
Other DBs
NCBI-GeneID: 5013
NCBI-ProteinID: NP_001186699
OMIM: 600036
HGNC: 8521
Ensembl: ENSG00000115507
Vega: OTTHUMG00000129454
Pharos: P32242(Tbio)
UniProt: P32242
LinkDB
Position
2:63049735..63057831
AA seq 354 aa
MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKT
RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSG
SESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPA
SISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSS
SYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHH
HQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgatgtcttacctcaaacaacccccatacggcatgaacgggctgggcctggccgggccc
gccatggacctcctgcacccatccgtgggctatccggccactccgcggaagcagcggcgg
gagcgcaccaccttcacgcgttcacagctggacgtgctcgaggcgctcttcgccaagact
cgctaccctgacatcttcatgcgggaggaggtggcgctcaagatcaacctgccggagtct
agagtccaggtctggttcaagaaccgccgcgccaaatgccgccagcagcagcagagcggg
agcggaaccaagagccgcccagccaagaagaagtcctctccagtgcgggagagctcgggc
tccgaaagcagtggccaattcacgccgccagctgtgtccagctctgcctcgtcctctagc
tcggcgtccagctcttccgccaacccagcggctgcagcggctgcgggactaggtgggaac
ccggtggcggccgcgtcgtcgctgagtacaccagctgcctcatctatctggagcccggcc
tccatctcgccaggctcagcgcccgcgtccgtgtcggtgccggagccattggccgcgcct
agcaacacctcgtgtatgcagcgctccgtagctgcaggcgccgccaccgcagcagcctct
tatcccatgtcctacggccagggcggcagctacggccaaggctaccctacgccctcctct
tcctactttggcggcgtggactgcagctcatacctagcgcccatgcactcacatcaccac
ccgcaccagctcagccccatggcaccctcctccatggcgggccaccatcatcaccaccca
catgcgcaccacccgttgagccagtcctcaggccaccaccaccaccatcaccaccaccac
caccaaggctacggtggctctgggcttgccttcaactctgccgactgcttggattacaag
gagcctggcgccgctgctgcttcctccgcctggaaactcaacttcaactcccccgactgt
ctggactataaggaccaagcctcatggcggttccaggtcttgtga

DBGET integrated database retrieval system