KEGG   Homo sapiens (human): 5019
Entry
5019              CDS       T01001                                 
Symbol
OXCT1, OXCT, SCOT
Name
(RefSeq) 3-oxoacid CoA-transferase 1
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
Disease
H01121  Succinyl CoA:3-oxoacid CoA transferase (SCOT) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    5019 (OXCT1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    5019 (OXCT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     5019 (OXCT1)
SSDB
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Other DBs
NCBI-GeneID: 5019
NCBI-ProteinID: NP_000427
OMIM: 601424
HGNC: 8527
Ensembl: ENSG00000083720
Vega: OTTHUMG00000094783
Pharos: P55809(Tbio)
UniProt: P55809 A0A024R040
Structure
LinkDB
Position
5:complement(41730065..41870425)
AA seq 520 aa
MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVL
VGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENA
EFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSV
AIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAET
TVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDD
VRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEAD
ADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDK
KKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcggctctcaaactcctctcctccgggcttcggctctgcgcctctgcccgcggatct
ggggcaacctggtacaagggatgtgtttgttccttttccaccagtgctcatcgccatacc
aagttttatacagatccagtagaagctgtaaaagacatccctgatggtgccacggttttg
gttggtggttttgggctatgtggaattccagagaatcttatagatgctttactgaaaact
ggagtaaaaggactaactgcagtcagcaacaatgcaggggttgacaattttggtttgggg
cttttgcttcggtccaagcagataaaacgcatggtctcttcatatgtgggagaaaatgca
gaatttgaacgacagtacttatctggtgaattagaagtggagctgacaccacagggcaca
cttgcagagaggatccgtgcaggcggggctggagttcctgcattttacaccccaacaggg
tatgggaccctggtacaagaaggaggatcgcccatcaaatacaacaaagatggcagtgtt
gccattgccagtaagccaagagaggtgagggagttcaatggtcagcactttattttggag
gaagcaattacaggggattttgctttggtgaaagcctggaaggcggaccgagcaggaaac
gtgattttcaggaaaagtgcaaggaatttcaacttgccaatgtgcaaagctgcagaaacc
acagtggtagaggttgaagaaattgtggatattggagcatttgctccagaagacatccat
attcctcagatttatgtacatcgccttataaagggagaaaaatatgagaaaagaattgag
cgtttatcaatccggaaagagggagatggggaagccaaatctgctaaacctggagatgac
gtaagggaacgaatcatcaagagggccgctcttgagtttgaggatggcatgtatgctaat
ttgggcataggaatccctctcctggccagcaattttatcagcccaaatataactgttcat
cttcaaagtgaaaatggagttctgggtttgggtccatatccacgacaacatgaagctgat
gcagatctcatcaatgcaggcaaggaaacagttactattcttccaggagcctcttttttc
tccagcgatgaatcatttgcaatgattagaggtggacacgtcgatctgacaatgctagga
gcgatgcaggtttccaaatatggtgacctggctaactggatgatacctgggaagatggtg
aaaggaatgggaggtgctatggatttagtgtccagtgcgaaaaccaaagtggtggtcacc
atggagcattctgcaaagggaaatgcacataaaatcatggagaaatgtacattaccattg
actggaaagcaatgtgtcaaccgcattattactgaaaaggctgtgtttgatgtggacaag
aagaaagggttgactctgattgagctctgggaaggcctgacagtggatgacgtacagaag
agtactgggtgtgattttgcagtttcaccaaaactcatgccaatgcagcagatcgcaaat
tga

KEGG   Homo sapiens (human): 64064
Entry
64064             CDS       T01001                                 
Symbol
OXCT2, FKSG25, SCOTT
Name
(RefSeq) 3-oxoacid CoA-transferase 2
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    64064 (OXCT2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    64064 (OXCT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     64064 (OXCT2)
SSDB
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Other DBs
NCBI-GeneID: 64064
NCBI-ProteinID: NP_071403
OMIM: 610289
HGNC: 18606
Ensembl: ENSG00000198754
Vega: OTTHUMG00000009249
Pharos: Q9BYC2(Tbio)
UniProt: Q9BYC2
LinkDB
Position
1:complement(39769523..39771348)
AA seq 517 aa
MAALRLLASVLGRGVPAGGSGLALSQGCARCFATSPRLRAKFYADPVEMVKDISDGATVM
IGGFGLCGIPENLIAALLRTRVKDLQVVSSNVGVEDFGLGLLLAARQVRRIVCSYVGENT
LCESQYLAGELELELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGAPIRYTPDGHL
ALMSQPREVREFNGDHFLLERAIRADFALVKGWKADRAGNVVFRRSARNFNVPMCKAADV
TAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYEKRIERLTILKEEDGDAGKEEDART
RIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADL
INAGKQTVTVLPGGCFFASDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMIPGKKVKGM
GGAMDLVSSQKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKE
LTLRELWEGLTVDDIKKSTGCAFAVSPNLRPMQQVAP
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcggcgctgcggctcctggcgtcagtgctcgggcgcggggtccccgccggcggctca
gggctcgcgctgtcccagggctgcgcccgctgctttgccaccagtccccggctccgtgcc
aagttctacgcggacccggtggagatggtgaaggacatctctgacggggcgaccgtcatg
atcgggggcttcgggctctgcgggatccccgagaacctgatcgccgcgctgctcaggacc
cgcgtgaaagacctgcaggtggtcagcagcaacgtgggcgtggaggacttcggcctgggc
ctcctgctggccgccaggcaggtccgtcgcatcgtctgttcctacgtgggcgagaacacc
ctgtgcgagagccagtacctggcaggagagctggagctggagctcacgccccagggcacc
ctggccgagcgcatccgcgcggggggcgccggggtgcccgccttctacacccccacgggc
tacgggaccctggtccaggaagggggcgcccccatccgctacaccccggacggccacctg
gcgctcatgagccagccccgagaggtgagggagttcaacggcgaccacttccttttggag
cgcgccatccgggcagacttcgccctggtgaaagggtggaaggccgaccgggcaggaaac
gtggtcttcaggagaagcgcccgcaatttcaacgtgcccatgtgcaaagctgcagacgtc
acggcggtggaggtggaagagatcgtggaggtgggggctttccccccagaagacatccac
gttcctaacatttatgtagatcgcgtgataaaggggcagaaatacgagaaacgaattgag
cgcttaacgatcctgaaagaggaagatggagacgctggaaaggaagaggacgccaggacg
cgcatcatcagacgcgcagctctggaatttgaggacggcatgtacgccaatctgggcata
ggcatccccctgctggccagcaacttcatcagtcccagcatgactgtccatcttcacagt
gagaacgggatcctgggcctgggcccgtttcccacggaagatgaggtggatgccgacctc
atcaatgcaggcaagcagacggtcacggtgcttcccgggggctgcttcttcgccagcgac
gactccttcgccatgatccgagggggacacatccaactaaccatgcttggagccatgcag
gtttccaaatacggcgacctggcgaactggatgatccctggcaagaaggtgaaaggcatg
ggcggtgccatggacttggtgtccagtcagaagaccagagtggtggtcaccatgcagcac
tgcacaaaggacaacacccccaagatcatggagaaatgcaccatgccgctgaccgggaag
cggtgcgtggaccgcatcatcaccgagaaggccgtgtttgacgtgcacaggaagaaagag
ctgacgctgagggagctctgggagggcctgacggtggacgacatcaaaaagagcacgggg
tgtgcctttgctgtgtccccgaacctcaggcccatgcagcaggtggcaccctga

DBGET integrated database retrieval system