KEGG   Homo sapiens (human): 50511
Entry
50511             CDS       T01001                                 
Symbol
SYCP3, COR1, RPRGL4, SCP3, SPGF4
Name
(RefSeq) synaptonemal complex protein 3
  KO
K19528  synaptonemal complex protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Disease
H00890  Azoospermia
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    50511 (SYCP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    50511 (SYCP3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    50511 (SYCP3)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    50511 (SYCP3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Meiosis-specific sister chromatid cohesion proteins
   Synaptonemal complex
    50511 (SYCP3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     50511 (SYCP3)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   50511 (SYCP3)
SSDB
Motif
Pfam: Cor1 Peptidase_C65
Other DBs
NCBI-GeneID: 50511
NCBI-ProteinID: NP_001171419
OMIM: 604759
HGNC: 18130
Ensembl: ENSG00000139351
Pharos: Q8IZU3(Tbio)
UniProt: Q8IZU3 A0A024RBF8
Structure
LinkDB
Position
12:complement(101728648..101739462)
AA seq 236 aa
MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSA
GVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQK
LNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYE
QFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
NT seq 711 nt   +upstreamnt  +downstreamnt
atggtgtcctccggaaaaaagtattccaggaaatctgggaagccgtctgtggaagatcag
tttacgagagcctatgactttgagactgaagataagaaagatctgagtggatcagaggaa
gatgttattgaagggaagactgcagtcattgagaaacgtaggaagaaaaggtcttctgca
ggagtagttgaagatatggggggtgaagtgcagaatatgctggaaggagttggagttgac
attaacaaggctcttcttgccaagagaaagagactagaaatgtataccaaggcttctctc
aaaactagtaaccagaaaattgaacatgtttggaaaacacaacaagatcaaaggcagaag
cttaaccaagaatattctcagcagtttctgactttgtttcagcagtgggatttagatatg
cagaaagctgaggaacaagaagaaaaaatacttaatatgtttcgacagcaacaaaagatt
cttcaacaatctagaattgttcagagccagagattgaaaacaattaaacagttatatgag
cagttcataaagagtatggaagagttggagaagaatcatgataatctacttactggtgca
caaaatgaatttaaaaaagaaatggctatgttgcaaaaaaaaattatgatggaaactcag
cagcaagagatagcaagtgttcggaagtctcttcaatccatgttattctga

DBGET integrated database retrieval system