KEGG   Homo sapiens (human): 51004
Entry
51004             CDS       T01001                                 
Symbol
COQ6, CGI-10, CGI10, COQ10D6
Name
(RefSeq) coenzyme Q6, monooxygenase
  KO
K06126  ubiquinone biosynthesis monooxygenase Coq6 [EC:1.14.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00130  Ubiquinone and other terpenoid-quinone biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00128  Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate + polyprenyl-PP => ubiquinol
Disease
H00999  Coenzyme Q10 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    51004 (COQ6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-
     51004 (COQ6)
SSDB
Motif
Pfam: FAD_binding_3 SE Hpt
Other DBs
NCBI-GeneID: 51004
NCBI-ProteinID: NP_872282
OMIM: 614647
HGNC: 20233
Ensembl: ENSG00000119723
Pharos: Q9Y2Z9(Tbio)
UniProt: Q9Y2Z9
LinkDB
Position
14:73949926..73963670
AA seq 468 aa
MAARLVSRCGAVRAAPHSGPLVSWRRWSGASTDTVYDVVVSGGGLVGAAMACALGYDIHF
HDKKILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQV
WDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSDRVTVLYRSKAIRYTWPCPF
PMADSSPWVHITLGDGSTFQTKLLIGADGHNSGVRQAVGIQNVSWNYDQSAVVATLHLSE
ATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVDAVNSAFWSD
ADHTDFIDTAGAMLQYAVSLLKPTKVSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPR
VALIGDAAHRVHPLAGQGVNMGFGDISSLAHHLSTAAFNGKDLGSVSHLTGYETERQRHN
TALLAATDLLKRLYSTSASPLVLLRTWGLQATNAVSPLKEQIMAFASK
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggcggcccggcttgtcagccgatgcggggctgtgcgtgcagctccccacagcggcccg
ctggtgtcctggcgcaggtggtccggcgcctcaacagacaccgtgtatgacgtggtggtg
tcgggtggaggcctggtgggcgctgccatggcctgtgccttgggatatgatattcacttt
catgacaagaaaatcctgttgctcgaagcaggtccaaagaaagtactggagaaattgtca
gaaacttacagcaacagggtcagctccatttcccctggctctgcaacgcttctcagtagt
tttggtgcctgggaccatatctgcaacatgagatacagagcctttcggcgaatgcaggtg
tgggacgcctgctcagaggccctgataatgtttgataaggataatttagatgacatgggc
tatatcgtggagaatgatgtcatcatgcatgctctcactaagcagttggaggctgtgtct
gaccgagtgacggttctctacaggagcaaagccattcgctatacctggccttgtccattt
cctatggccgactccagcccttgggttcatattaccctaggtgatggcagcaccttccag
accaaattgttgataggtgcagatggtcacaactccggagtacggcaggctgttggaatc
cagaatgtgagctggaactatgaccagtctgctgttgtggctactctgcatttatcagag
gccacagaaaacaacgtagcctggcagagatttcttccctctgggcctattgctctgctc
ccgctctcagacaccttgagttccttggtttggtccacgtcccatgaacatgcagcagag
ctagttagcatggatgaggaaaaatttgtggatgccgttaactctgccttttggagtgat
gctgaccacacggacttcatcgacacagctggtgccatgctgcagtatgctgtcagcctt
ctgaagcccactaaggtctcggctcgccagctgcccccaagcgtagccagggtggatgcc
aaaagccgagttctgtttcctcttgggttgggacatgctgctgagtacgtcaggcctcgg
gtggcgctcattggggatgcagcccacagagtccatccgcttgcaggacagggtgtcaac
atgggctttggggatatctccagcttggcccatcacctcagtacggcagccttcaatggg
aaggacttaggttccgtgagccacctcacaggttatgaaacagaaagacagcgtcacaac
actgctcttctggctgctacagacttactaaaaaggctctattctaccagtgcctccccg
cttgtgttgctcaggacgtggggcttgcaggccacaaatgcagtgtctccactcaaagaa
cagattatggcctttgcaagcaaatga

DBGET integrated database retrieval system