KEGG   Homo sapiens (human): 51019
Entry
51019             CDS       T01001                                 
Symbol
WASHC3, CCDC53, CGI-116
Name
(RefSeq) WASH complex subunit 3
  KO
K18463  WASH complex subunit CCDC53
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51019 (WASHC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51019 (WASHC3)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Others
   WASH complex
    51019 (WASHC3)
SSDB
Motif
Pfam: CCDC53 NB-LRR GRDA
Other DBs
NCBI-GeneID: 51019
NCBI-ProteinID: NP_057137
HGNC: 24256
Ensembl: ENSG00000120860
Pharos: Q9Y3C0(Tdark)
UniProt: Q9Y3C0
LinkDB
Position
12:complement(102012840..102062124)
AA seq 194 aa
MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQ
QIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQES
EVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEK
TVEESSDSESSFSD
NT seq 585 nt   +upstreamnt  +downstreamnt
atggatgaggacgggcttcctctcatggggtcaggcatagacctgaccaaggtgccagct
attcaacagaaaagaacggtggcttttctaaaccaatttgtggtgcacactgtacagttc
ctcaaccgcttttctacagtttgtgaggagaaactggcagacctttcacttcgtatccaa
caaattgaaacaactctcaatattttagatgcaaagttgtcatctatcccaggcctagat
gatgtcacagttgaagtatctcctttaaatgtcaccagtgtcacaaatggagcacatcct
gaagccacttcagagcaaccacagcagaacagtacacaagactctggactacaggaaagt
gaagtatcagcagaaaatatcttaactgtagccaaggatccaagatatgccagatatctc
aaaatggttcaagtgggtgtaccagtgatggcaataagaaacaaaatgatatcagaagga
ctagacccagatcttcttgagaggccagatgctccagtgcctgatggcgaaagtgagaaa
actgtagaagaaagttcagatagcgaatcttcttttagtgattaa

DBGET integrated database retrieval system