KEGG   Homo sapiens (human): 5119
Entry
5119              CDS       T01001                                 
Symbol
CHMP1A, CHMP1, PCH8, PCOLN3, PRSM1, VPS46-1, VPS46A
Name
(RefSeq) charged multivesicular body protein 1A
  KO
K12197  charged multivesicular body protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5119 (CHMP1A)
  09143 Cell growth and death
   04217 Necroptosis
    5119 (CHMP1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5119 (CHMP1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5119 (CHMP1A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    5119 (CHMP1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5119 (CHMP1A)
  Exosomal proteins of other body fluids (saliva and urine)
   5119 (CHMP1A)
  Exosomal proteins of colorectal cancer cells
   5119 (CHMP1A)
SSDB
Motif
Pfam: Snf7 DUF6247 MS_channel Ist1
Other DBs
NCBI-GeneID: 5119
NCBI-ProteinID: NP_002759
OMIM: 164010
HGNC: 8740
Ensembl: ENSG00000131165
Pharos: Q9HD42(Tbio)
UniProt: Q9HD42
Structure
LinkDB
Position
16:complement(89644435..89657708)
AA seq 196 aa
MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGV
NWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQ
NLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSV
RSQEDQLSRRLAALRN
NT seq 591 nt   +upstreamnt  +downstreamnt
atggacgataccctgttccagttgaagttcacggcgaagcagctggagaagctggccaag
aaggcggagaaggactccaaggcggagcaggccaaagtgaagaaggcccttctgcagaaa
aatgtagagtgtgcccgtgtgtatgccgagaacgccatccgcaagaagaacgaaggtgtg
aactggcttcggatggcgtcccgcgtagacgcagtggcctccaaggtgcagacagctgtg
actatgaagggggtgaccaagaatatggcccaggtgaccaaagccctggacaaggccctg
agcaccatggacctgcagaaggtctcctcagtgatggacaggttcgagcagcaggtgcag
aacctggacgtccatacatcggtgatggaggactccatgagctcggccaccaccctgacc
acgccgcaggagcaggtggacagcctcatcatgcagatcgccgaggagaatggcctggag
gtgctggaccagctcagccagctgcccgagggcgcctctgccgtgggcgagagctctgtg
cgcagccaggaggaccagctgtcacggaggttggccgccttgaggaactag

KEGG   Homo sapiens (human): 57132
Entry
57132             CDS       T01001                                 
Symbol
CHMP1B, C10orf2, C18-ORF2, C18orf2, CHMP1.5, Vps46-2, Vps46B, hVps46-2
Name
(RefSeq) charged multivesicular body protein 1B
  KO
K12197  charged multivesicular body protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    57132 (CHMP1B)
  09143 Cell growth and death
   04217 Necroptosis
    57132 (CHMP1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57132 (CHMP1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    57132 (CHMP1B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    57132 (CHMP1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   57132 (CHMP1B)
  Exosomal proteins of other body fluids (saliva and urine)
   57132 (CHMP1B)
  Exosomal proteins of colorectal cancer cells
   57132 (CHMP1B)
SSDB
Motif
Pfam: Snf7 Ist1 FlxA Mu-like_Pro Mt_ATP-synt_D DUF948
Other DBs
NCBI-GeneID: 57132
NCBI-ProteinID: NP_065145
OMIM: 606486
HGNC: 24287
Ensembl: ENSG00000255112
Pharos: Q7LBR1(Tbio)
UniProt: Q7LBR1
Structure
LinkDB
Position
18:11851413..11854444
AA seq 199 aa
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtctaacatggagaaacacctgttcaacctgaagttcgcggccaaagaactgagtagg
agtgccaaaaaatgcgataaggaggaaaaggccgaaaaggccaaaattaaaaaggccatt
cagaagggcaacatggaagttgcgaggatacacgccgaaaatgccatccgccagaagaac
caggcggtgaatttcttgagaatgagtgcgcgagtcgatgcagtggctgccagggtccag
acggcggtgacgatgggcaaggtgaccaagtcgatggctggtgtggttaagtcgatggat
gcgacattgaagaccatgaatctggagaagatttctgctttgatggacaaattcgagcac
cagtttgagactctggacgtccagacgcagcaaatggaagacacgatgagcagcacgacg
acgctcaccactccccagaaccaagtggatatgctgctccaggaaatggcagatgaggcg
ggcctcgacctcaacatggagctgccgcagggccagaccggctccgtgggcacgagcgtg
gcttcggcggagcaggatgaactgtctcagagactggcccgccttcgggatcaagtgtga

DBGET integrated database retrieval system