KEGG   Homo sapiens (human): 51289
Entry
51289             CDS       T01001                                 

Gene name
RXFP3, GPCR135, RLN3R1, RXFPR3, SALPR
Definition
(RefSeq) relaxin family peptide receptor 3
  KO
K08397  relaxin family peptide receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    51289 (RXFP3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    51289 (RXFP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    51289 (RXFP3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Relaxin
    51289 (RXFP3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 51289
NCBI-ProteinID: NP_057652
OMIM: 609445
HGNC: 24883
Ensembl: ENSG00000182631
Vega: OTTHUMG00000090685
Pharos: Q9NSD7(Tbio)
UniProt: Q9NSD7
LinkDB
Position
5p13.2
AA seq 469 aa
MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDGA
PPGHPPGSGGAESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLF
VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTR
YHSVASALKSHRTRGHGRGDCCGRSLGDSCCFSAKALCVWIWALAALASLPSAIFSTTVK
VMGEELCLVRFPDKLLGRDRQFWLGLYHSQKVLLGFVLPLGIIILCYLLLVRFIADRRAA
GTKGGAAVAGGRPTGASARRLSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAVPFS
QEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRKALKSLLWRIASPSITSMRPFTA
TTKPEHEDQGLQAPAPPHAAAEPDLLYYPPGVVVYSGGRYDLLPSSSAY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgcagatggccgatgcagccacgatagccaccatgaataaggcagcaggcggggacaag
ctagcagaactcttcagtctggtcccggaccttctggaggcggccaacacgagtggtaac
gcgtcgctgcagcttccggacttgtggtgggagctggggctggagttgccggacggcgcg
ccgccaggacatcccccgggcagcggcggggcagagagcgcggacacagaggcccgggtg
cggattctcatcagcgtggtgtactgggtggtgtgcgccctggggttggcgggcaacctg
ctggttctctacctgatgaagagcatgcagggctggcgcaagtcctctatcaacctcttc
gtcaccaacctggcgctgacggactttcagtttgtgctcaccctgcccttctgggcggtg
gagaacgctcttgacttcaaatggcccttcggcaaggccatgtgtaagatcgtgtccatg
gtgacgtccatgaacatgtacgccagcgtgttcttcctcactgccatgagtgtgacgcgc
taccattcggtggcctcggctctgaagagccaccggacccgaggacacggccggggcgac
tgctgcggccggagcctgggggacagctgctgcttctcggccaaggcgctgtgtgtgtgg
atctgggctttggccgcgctggcctcgctgcccagtgccattttctccaccacggtcaag
gtgatgggcgaggagctgtgcctggtgcgtttcccggacaagttgctgggccgcgacagg
cagttctggctgggcctctaccactcgcagaaggtgctgctgggcttcgtgctgccgctg
ggcatcattatcttgtgctacctgctgctggtgcgcttcatcgccgaccgccgcgcggcg
gggaccaaaggaggggccgcggtagccggaggacgcccgaccggagccagcgcccggaga
ctgtcgaaggtcaccaaatcagtgaccatcgttgtcctgtccttcttcctgtgttggctg
cccaaccaggcgctcaccacctggagcatcctcatcaagttcaacgcggtgcccttcagc
caggagtatttcctgtgccaggtatacgcgttccctgtgagcgtgtgcctagcgcactcc
aacagctgcctcaaccccgtcctctactgcctcgtgcgccgcgagttccgcaaggcgctc
aagagcctgctgtggcgcatcgcgtctccttcgatcaccagcatgcgccccttcaccgcc
actaccaagccggagcacgaggatcaggggctgcaggccccggcgccgccccacgcggcc
gcggagccggacctgctctactacccacctggcgtcgtggtctacagcggggggcgctac
gacctgctgcccagcagctctgcctactga

DBGET integrated database retrieval system