KEGG   Homo sapiens (human): 5130
Entry
5130              CDS       T01001                                 

Gene name
PCYT1A, CCTA, CCTalpha, CT, CTA, CTPCT, PCYT1, SMDCRD
Definition
(RefSeq) phosphate cytidylyltransferase 1A, choline
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00440  Phosphonate and phosphinate metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa05231  Choline metabolism in cancer
Module
hsa_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Disease
H01821  Spondylometaphyseal dysplasia with cone-rod dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5130 (PCYT1A)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    5130 (PCYT1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    5130 (PCYT1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     5130 (PCYT1A)
SSDB
Motif
Pfam: CTP_transf_like hNIFK_binding DUF1664 YtxH
Other DBs
NCBI-GeneID: 5130
NCBI-ProteinID: NP_001299602
OMIM: 123695
HGNC: 8754
Ensembl: ENSG00000161217
Vega: OTTHUMG00000155670
Pharos: P49585(Tbio)
UniProt: P49585 B4E322
LinkDB
Position
3q29
AA seq 367 aa
MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYV
RVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHN
FKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKY
HLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGALK
HMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPANLSRHKAAAYD
ISEDEED
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggatgcacagtgttcagccaaggtcaatgcaaggaagaggagaaaagaggcgcccgga
cccaacggggcaacagaagaagatggggttccttccaaagtgcagcgctgtgcagtgggc
ttacggcaaccagctcctttttctgatgaaattgaagttgactttagtaagccctatgtc
agggtaactatggaagaagccagcagaggaactccttgtgagcgacctgtgagagtttat
gccgatggaatatttgacttatttcactctggtcacgcccgagctctgatgcaagcgaag
aaccttttccctaatacgtacctcattgtgggagtttgcagtgatgagctcacacacaac
ttcaaaggcttcacggtgatgaacgagaatgagcgctatgacgcagtccagcactgccgc
tacgtggatgaggtggtgaggaatgcgccctggacgctgacacccgagttcctggccgaa
caccggattgattttgtagcccatgatgatattccttattcatctgctggcagtgatgat
gtttataagcacatcaaggaggcaggcatgtttgctccaacacagaggacagaaggtatc
tccacatcagacatcatcacccgaattgtgcgggattatgatgtgtatgcgaggcggaac
ctgcagaggggctacacagcaaaggagctcaatgtcagctttatcaacgagaagaaatac
cacttgcaggagagggttgacaaagtaaagaagaaagtgaaagatgtggaggaaaagtca
aaagaatttgttcagaaggtggaggaaaaaagcattgacctcattcagaagtgggaggag
aagtcccgagaattcattggaagttttctggaaatgtttggtccggaaggagcactgaaa
catatgctgaaagaggggaagggccggatgctgcaggccatcagcccgaagcagagcccc
agcagcagccctactcgcgagcgctccccctccccctctttccgatggcccttctccggc
aagacttccccaccttgctccccagcaaatctctccaggcacaaggctgcagcctatgat
atcagtgaggatgaagaagactaa

KEGG   Homo sapiens (human): 9468
Entry
9468              CDS       T01001                                 

Gene name
PCYT1B, CCTB, CTB
Definition
(RefSeq) phosphate cytidylyltransferase 1B, choline
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00440  Phosphonate and phosphinate metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa05231  Choline metabolism in cancer
Module
hsa_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    9468 (PCYT1B)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    9468 (PCYT1B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    9468 (PCYT1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     9468 (PCYT1B)
SSDB
Motif
Pfam: CTP_transf_like Lipoprotein_6 YtxH
Other DBs
NCBI-GeneID: 9468
NCBI-ProteinID: NP_004836
OMIM: 300948
HGNC: 8755
Ensembl: ENSG00000102230
Vega: OTTHUMG00000021270
Pharos: Q9Y5K3(Tbio)
UniProt: Q9Y5K3
LinkDB
Position
Xp22.11
AA seq 369 aa
MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHE
KLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHK
FKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRY
RFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWK
QMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISS
MSEGDEDEK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccagtagttaccactgatgctgagtcagaaacaggtatcccaaaatccctttccaat
gagcctccctcagaaaccatggaggaaatagagcacacatgcccacagcctcgactgacc
ctgactgcacctgccccatttgctgatgaaaccaactgccagtgtcaagcaccccatgaa
aaactgaccattgctcaggcccgcttaggaacaccagctgacaggcctgtcagagtatac
gccgatggaatatttgacctcttccactcaggtcatgcaagagcccttatgcaagcaaaa
acactgtttcccaacagctacttgttggtaggagtttgcagtgatgatctcacccacaaa
ttcaaaggtttcaccgtgatgaatgaagccgagagatacgaagctctcagacactgtcgc
tacgtagacgaagttatcagagatgctccctggacactcacgccagagtttctggaaaaa
cacaagattgactttgtggctcatgatgacattccgtattcctctgctggctctgatgat
gtttacaagcacataaaggaagcagggatgttcgttccaacgcagagaacagaaggcatc
tcaacatcggacatcattaccagaattgttcgtgactatgatgtttatgcccgacgtaac
ctccagagagggtatacagccaaggaactgaatgtcagctttataaatgagaagaggtac
cgtttccagaaccaagtggacaaaatgaaggaaaaagtcaagaatgtggaggaaagatca
aaggaatttgtgaacagagtggaagaaaagagccatgatctaattcaaaagtgggaagag
aagtcaagggaattcattggcaacttcctagaactgtttggacctgatggagcatggaag
cagatgttccaggagaggagcagccggatgctgcaggccttatccccgaagcagagccct
gtgagcagcccaacccggagccggtccccttcccgctccccatcgcccaccttctcatgg
cttccactcaaaacctcacccccttcctcacccaaagcagcctcagcctctatcagcagc
atgagcgagggggatgaggatgaaaagtag

DBGET integrated database retrieval system