KEGG   Homo sapiens (human): 51471
Entry
51471             CDS       T01001                                 
Symbol
NAT8B, CML2, Hcml2, NAT8BP
Name
(RefSeq) N-acetyltransferase 8B (putative, gene/pseudogene)
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    51471 (NAT8B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     51471 (NAT8B)
    2.3.1.-
     51471 (NAT8B)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_9 Acetyltransf_4 FR47 Acetyltransf_3 Acetyltransf_8 Acetyltransf_15
Other DBs
NCBI-GeneID: 51471
NCBI-ProteinID: NP_057431
OMIM: 608190
HGNC: 30235
Ensembl: ENSG00000204872
Vega: OTTHUMG00000152811
Pharos: Q9UHF3(Tbio)
UniProt: Q9UHF3
LinkDB
Position
2:complement(73700509..73701340)
AA seq 227 aa
MAPYHIRKYQESDRKSVVGLLSRGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSW
ILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVG
TVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNI
QLSAMGLYQSLGFKKTGQSFFHVWARLVDLHTVHFIYHLPSAQAGRL
NT seq 684 nt   +upstreamnt  +downstreamnt
atggctccttatcacatccgcaaataccaggagagcgaccgcaagtcggtcgtgggcttg
ctctcccgggggatggccgaacacgccccagccaccttccggcgattactgaagctgcct
cgaaccctcatactcttacttgggggggcccttgccctactcctggtctctggctcctgg
attctggccctcgtgttcagcctcagcctccttcctgccctgtggttccttgccaaaaaa
ccctggacgcggtatgtagacatagcattgcgcacagacatgtctgacatcaccaaatcc
tacctgagtgagtgtggctcctgcttctgggtgggtgaatctgaagagaaggtggtgggc
acagtaggagctctgcccgttgatgatcccaccttgagggagaagcggttgcagctgttt
catctctctgtggacaatgagcaccgtggtcaggggatagcaaaagccctggtcaggact
gtcctccagtttgcccgggaccagggctacagtgaagttgtcctggacaccagcaacatc
cagctctctgccatgggcctctaccagagcttgggcttcaagaagacgggccagtccttc
ttccacgtgtgggccaggctggtggatcttcatacagttcatttcatctatcacctccct
tctgctcaggcagggcgtctatga

KEGG   Homo sapiens (human): 9027
Entry
9027              CDS       T01001                                 
Symbol
NAT8, ATase2, CCNAT, CML1, GLA, Hcml1, TSC501, TSC510
Name
(RefSeq) N-acetyltransferase 8 (putative)
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    9027 (NAT8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     9027 (NAT8)
    2.3.1.-
     9027 (NAT8)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_9 Acetyltransf_4 Acetyltransf_3 FR47 Acetyltransf_13 Acetyltransf_15 Acetyltransf_8
Other DBs
NCBI-GeneID: 9027
NCBI-ProteinID: NP_003951
OMIM: 606716
HGNC: 18069
Ensembl: ENSG00000144035
Vega: OTTHUMG00000129818
Pharos: Q9UHE5(Tbio)
UniProt: Q9UHE5
LinkDB
Position
2:complement(73640723..73642422)
AA seq 227 aa
MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSW
LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVG
MVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTI
QLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL
NT seq 684 nt   +upstreamnt  +downstreamnt
atggctccttgtcacatccgcaaataccaggagagcgaccgccagtgggttgtgggcttg
ctctcccgggggatggccgagcatgccccagccaccttccggcaattgctgaagctgcct
cgaaccctcatactcttacttggggggcccctcgccctactcctggtctctggatcctgg
cttctagccctcgtgttcagcatcagcctcttccctgccctgtggttccttgccaaaaaa
ccctggacggagtatgtggacatgacattgtgcacagacatgtctgacattaccaaatcc
tacctgagtgagcgtggctcctgcttctgggtggctgagtctgaagagaaggtggtgggc
atggtaggagctctgcctgttgatgatcccaccttgagggagaagcggttgcagctgttt
catctctttgtggacagtgagcaccgtcgtcaggggatagcaaaagccctggtcaggact
gtcctccagtttgcccgggaccagggctacagtgaagttatcctggacaccggcaccatc
cagctctctgctatggccctctaccagagcatgggcttcaagaagacgggccagtccttc
ttctgtgtgtgggccaggctagtggctcttcatacagttcatttcatctaccacctccct
tcttctaaggtagggagtctgtga

DBGET integrated database retrieval system