KEGG   Homo sapiens (human): 51616
Entry
51616             CDS       T01001                                 

Gene name
TAF9B, DN-7, DN7, TAF9L, TAFII31L, TFIID-31
Definition
(RefSeq) TATA-box binding protein associated factor 9b
  KO
K03133  transcription initiation factor TFIID subunit 9B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    51616 (TAF9B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    51616 (TAF9B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51616 (TAF9B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     51616 (TAF9B)
   Coactivators
    SAGA/TFTC/STAGA complex
     51616 (TAF9B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     51616 (TAF9B)
    STAGA complex
     51616 (TAF9B)
    TFTC complex
     51616 (TAF9B)
    SAGA complex
     51616 (TAF9B)
    SLIK complex
     51616 (TAF9B)
SSDB
Motif
Pfam: TFIID-31kDa CENP-S Bromo_TP Histone CENP-T_C
Other DBs
NCBI-GeneID: 51616
NCBI-ProteinID: NP_057059
OMIM: 300754
HGNC: 17306
Ensembl: ENSG00000187325
Vega: OTTHUMG00000021887
Pharos: Q9HBM6(Tbio)
UniProt: Q9HBM6
LinkDB
Position
Xq21.1
AA seq 251 aa
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRY
CLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTS
QRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKR
KHEDDDDNDIM
NT seq 756 nt   +upstreamnt  +downstreamnt
atggagtcgggcaagatggcgcctcccaagaacgctccgagagatgccttggtgatggca
cagatcctgaaggatatgggaatcacagagtatgaaccaagggttataaatcaaatgttg
gaatttgctttccgttatgtgactacaattctggatgatgcaaaaatttattcgagccat
gctaagaaacctaatgttgatgcagatgatgtgagactggcaatccagtgtcgtgctgac
caatcttttacctctcctcccccaagagattttttactggatatcgcaaggcagaaaaat
caaacccctttgccactgattaagccatatgcaggacctagactgccacctgatagatac
tgcttaacagctccaaactataggctgaagtccttaattaaaaagggacctaaccaaggg
agactagttccacgattaagtgttggtgctgttagtagcaaacctactactcctactata
gcaaccccacaaacggtgtctgtcccaaataaagttgcaactccaatgtcagtgacaagc
caaagatttacggtgcagattccaccttctcagtccacacctgtcaaaccagttcctgca
acaactgcagttcaaaatgttctgattaatccttcaatgattgggcccaaaaatattctt
attaccaccaacatggtttcgtcacagaacacagccaatgaagcaaacccactgaagaga
aaacatgaagatgatgatgacaatgatattatgtaa

KEGG   Homo sapiens (human): 6880
Entry
6880              CDS       T01001                                 

Gene name
TAF9, MGC:5067, STAF31/32, TAF2G, TAFII-31, TAFII-32, TAFII31, TAFII32, TAFIID32
Definition
(RefSeq) TATA-box binding protein associated factor 9
  KO
K14535  transcription initiation factor TFIID subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6880 (TAF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6880 (TAF9)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6880 (TAF9)
   Coactivators
    SAGA/TFTC/STAGA complex
     6880 (TAF9)
SSDB
Motif
Pfam: TFIID-31kDa CENP-S Bromo_TP Histone CENP-T_C
Other DBs
NCBI-GeneID: 6880
NCBI-ProteinID: NP_001015892
OMIM: 600822
HGNC: 11542
Ensembl: ENSG00000273841
Vega: OTTHUMG00000099359
Pharos: Q16594(Tbio)
UniProt: Q16594
LinkDB
Structure
PDB: 
6F3T 6MZC 6MZM 6MZD 6MZL

Position
5q13.2
AA seq 264 aa
MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
CLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPM
SLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANES
SNALKRKREDDDDDDDDDDDYDNL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggagtctggcaagacggcttctcccaagagcatgccgaaagatgcacagatgatggca
caaatcctgaaggatatggggattacagaatatgagccaagagttataaatcagatgttg
gagtttgccttccgatatgtgaccacaattctagatgatgcaaaaatttattcaagccat
gctaagaaagctactgttgatgcagatgatgtgcgattggcaatccagtgccgcgctgat
cagtcttttacctctcctcccccaagagattttttattagatattgcaaggcaaagaaat
caaacccctttgccattgatcaagccatattcaggtcctaggttgccacctgatagatac
tgcttaacagctccaaactataggctgaaatctttacagaaaaaggcatcaacttctgcg
ggaagaataacagtcccgcggttaagtgttggttcagttactagcagaccaagtactccc
acactaggcacaccaaccccacagaccatgtctgtttcaactaaagtagggactcccatg
tccctcacaggtcaaaggtttacagtacagatgcctacttctcagtctccagctgtaaaa
gcttcaattcctgcaacctcagcagttcagaatgttctgattaatccatcattaatcggg
tccaaaaacattcttattaccactaatatgatgtcatcacaaaatactgccaatgaatca
tcaaatgcattgaaaagaaaacgtgaagatgatgatgatgacgatgatgatgatgatgac
tatgataatctgtaa

DBGET integrated database retrieval system