KEGG   Homo sapiens (human): 5164
Entry
5164              CDS       T01001                                 
Symbol
PDK2, PDHK2, PDKII
Name
(RefSeq) pyruvate dehydrogenase kinase 2
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05415  Diabetic cardiomyopathy
Drug target
Sodium dichloroacetate: D05857
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    5164 (PDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5164 (PDK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     5164 (PDK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   5164 (PDK2)
SSDB
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 5164
NCBI-ProteinID: NP_002602
OMIM: 602525
HGNC: 8810
Ensembl: ENSG00000005882
Vega: OTTHUMG00000161948
Pharos: Q15119(Tbio)
UniProt: Q15119
Structure
LinkDB
Position
17:50094737..50112152
AA seq 407 aa
MRWVWALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcgctgggtgtgggcgctgctgaagaatgcgtccctggcaggggcgcccaagtacata
gagcacttcagcaagttctccccgtccccgctgtccatgaagcagtttctggacttcgga
tccagcaatgcctgtgagaaaacctccttcaccttcctcaggcaggagctgcctgtgcgc
ctggccaacatcatgaaagagatcaacctgcttcccgaccgagtgctgagcacaccctcc
gtgcagctggtgcagagctggtatgtccagagcctcctggacatcatggagttcctggac
aaggatcccgaggaccatcgcaccctgagccagttcactgacgccctggtcaccatccgg
aaccggcacaacgacgtggtgcccaccatggcacaaggcgtgcttgagtacaaggacacc
tacggcgatgaccccgtctccaaccagaacatccagtacttcctggaccgcttctacctc
agccgcatctccatccgcatgctcatcaaccagcacaccctcatctttgatggcagcacc
aacccagcccatcccaaacacatcggcagcatcgaccccaactgcaacgtctctgaggtg
gtcaaagatgcctacgacatggctaagctcctgtgtgacaagtattacatggcctcacct
gacctggagatccaggagatcaatgcagccaactccaaacagccgattcacatggtctac
gtcccctcccacctctaccacatgctctttgagctcttcaagaatgccatgagggcgact
gtggaaagccatgagtccagcctcattctcccacccatcaaggtcatggtggccttgggt
gaggaagatctgtccatcaagatgagtgaccgaggtgggggtgttcccttgaggaagatt
gagcgactcttcagctacatgtactccacagcacccaccccccagcctggcaccggggga
acgccgctggctggctttggttatgggctccccatttcccgcctctacgccaagtacttc
cagggagacctgcagctcttctccatggaaggctttgggaccgatgctgtcatctatctc
aaggccctgtccacggactcggtggagcgcctgcctgtctacaacaagtcagcctggcgc
cactaccagaccatccaggaggccggcgactggtgtgtgcccagcacggagcccaagaac
acgtccacgtaccgcgtcagctaa

KEGG   Homo sapiens (human): 5165
Entry
5165              CDS       T01001                                 
Symbol
PDK3, CMTX6, GS1-358P8.4
Name
(RefSeq) pyruvate dehydrogenase kinase 3
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05415  Diabetic cardiomyopathy
Disease
H00264  Charcot-Marie-Tooth disease
Drug target
Sodium dichloroacetate: D05857
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    5165 (PDK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5165 (PDK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     5165 (PDK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   5165 (PDK3)
SSDB
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 5165
NCBI-ProteinID: NP_005382
OMIM: 300906
HGNC: 8811
Ensembl: ENSG00000067992
Vega: OTTHUMG00000021269
Pharos: Q15120(Tbio)
UniProt: Q15120
Structure
LinkDB
Position
X:24465286..24550466
AA seq 406 aa
MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHN
DVVPTMAQGVIEYKEKFGFDPFISTNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgcggctgttccggtggctgctgaagcagccggtgcccaagcagatcgagcgctactcg
cgcttttcgccgtcgccgctctccatcaaacaattcctggacttcgggagagataatgca
tgtgagaaaacttcatatatgtttctacgaaaggaacttcctgtgcggctggctaacaca
atgagagaagttaatcttctgccggataatttacttaaccgcccttcagtgggattggtt
cagagttggtatatgcagagttttcttgaacttttagaatatgaaaataagagccctgag
gatccacaggtcttggataactttctacaagttctgattaaagtcagaaatagacacaat
gatgtggttcctacaatggcacaaggagtgattgaatacaaggagaagtttgggtttgat
cctttcattagcactaacatccaatattttctggatcggttttataccaaccgcatctct
ttccgcatgcttattaatcagcacacacttctgtttgggggtgacactaatcctgttcat
cctaaacacataggaagtatcgatcccacctgtaacgtggcggatgtggtgaaagatgca
tatgaaacagccaagatgctgtgtgaacagtattacctggtagctccagagctggaagtt
gaagaattcaatgccaaagcgccagacaaacctattcaggtggtttatgtgccctcacat
ctgtttcatatgctatttgagttgttcaagaactcaatgagagcgacagttgaactctat
gaagacagaaaagagggctaccctgctgttaaaaccctcgttactttgggtaaagaagac
ttatccattaagatcagtgacctaggtggtggtgtcccacttcgaaaaatagatcgtctt
tttaactacatgtattctactgctcctagacccagcctggagcctaccagagctgcccct
ttggctggatttggttatggtttgccaatttcccgtctgtatgctagatattttcaagga
gatctgaaactgtattccatggaaggagtgggtactgatgctgtcatttatttgaaggct
ctttcaagtgagtcatttgagagacttccagtttttaataagtccgcatggcgccattac
aagaccacgcctgaagccgatgattggagcaatcccagcagtgaacccagggatgcttca
aaatacaaagcaaaacagtaa

KEGG   Homo sapiens (human): 5166
Entry
5166              CDS       T01001                                 
Symbol
PDK4
Name
(RefSeq) pyruvate dehydrogenase kinase 4
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05415  Diabetic cardiomyopathy
Drug target
Sodium dichloroacetate: D05857
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    5166 (PDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5166 (PDK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     5166 (PDK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   5166 (PDK4)
SSDB
Motif
Pfam: BCDHK_Adom3 HATPase_c Adaptin_N CheB_methylest
Other DBs
NCBI-GeneID: 5166
NCBI-ProteinID: NP_002603
OMIM: 602527
HGNC: 8812
Ensembl: ENSG00000004799
Vega: OTTHUMG00000153977
Pharos: Q16654(Tbio)
UniProt: Q16654 A4D1H4
Structure
LinkDB
Position
7:complement(95583499..95596516)
AA seq 411 aa
MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQE
LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKLTQVNGKFPDQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaaggcggcccgcttcgtgctgcgcagcgctggctcgctcaacggcgccggcctggtg
ccccgagaggtggagcatttctcgcgctacagcccgtccccgctgtccatgaagcagcta
ctggactttggttcagaaaatgcatgtgaaagaacttcttttgcatttttgcgacaagaa
ttgcctgtgagactcgccaacattctgaaggaaattgatatcctcccgacccaattagta
aatacctcttcagtgcaattggttaaaagctggtatatacagagcctgatggatttggtg
gaattccatgagaaaagcccagatgaccagaaagcattatcagactttgtagatacactc
atcaaagttcgaaatagacaccataatgtagtccctacaatggcacaaggaatcatagag
tataaagatgcctgtacagttgacccagtcaccaatcaaaatcttcaatatttcttggat
cgattttacatgaaccgtatttctactcggatgctgatgaaccagcacattcttatattt
agtgactcacagacaggaaacccaagccacattggaagcattgatcctaactgtgatgtg
gtagcagtggtccaagatgcctttgagtgttcaaggatgctctgtgatcagtattattta
tcatctccagaattaaagcttacacaagtgaatggaaaatttccagaccaaccaattcac
atcgtgtatgttccttctcacctccatcatatgctctttgaactatttaagaatgcaatg
cgggcaacagttgaacaccaggaaaatcagccttcccttacaccaatagaggttattgtt
gtcttgggaaaagaagaccttaccattaagatttcagacagaggaggtggtgttcccctg
agaattattgaccgcctctttagttatacatactccactgcaccaacgcctgtgatggat
aattcccggaatgctcctttggctggttttggttacggcttgccaatttctcgtctgtat
gcaaagtactttcaaggagatctgaatctctactctttatcaggatatggaacagatgct
atcatctacttaaaggctttgtcttctgagtctatagaaaaacttccagtttttaacaag
tcagccttcaaacattatcagatgagctctgaggctgatgactggtgtatcccaagcagg
gaaccaaagaacctggcaaaagaagtggccatgtga

DBGET integrated database retrieval system